#ROSBAG V2.0 Echunk_count=conn_count= index_pos=, op= )compression=noneop= size=& conn=op= topic=/rosout$callerid=/record_1408447514146279968 latching=1'md5sum=acffd30cd6b6de30f120938c17c593fb7message_definition=## ## Severity level constants ## byte DEBUG=1 #debug level byte INFO=2 #general level byte WARN=4 #warning level byte ERROR=8 #error level byte FATAL=16 #fatal/critical level ## ## Fields ## Header header byte level string name # name of the node string msg # message string file # file the message came from string function # function the message came from uint32 line # line the message came from string[] topics # topic names that the node publishes ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id topic=/rosouttype=rosgraph_msgs/Log& conn=op= time=4S 4S /record_1408447514146279968Subscribing to /rosoutL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=4S*L 4S3 /record_1408447514146279968Subscribing to /rosout_aggL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=4S 4S^ /record_1408447514146279968>Subscribing to /camera/image/compressed/parameter_descriptionsL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=4Sc 4S /record_1408447514146279968>Subscribing to /camera/image/compressedDepth/parameter_updatesL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=4Sʄ 4S-m /record_1408447514146279968:Subscribing to /camera/image/theora/parameter_descriptionsL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=4Si4  4S. /record_14084475141462799685Subscribing to /camera/image/theora/parameter_updatesL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=4SS 4SQ /record_1408447514146279968#Subscribing to /camera/image/theoraL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=4Sr 4S o /record_1408447514146279968Subscribing to /camera/imageL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=4Sע  4S4 /record_1408447514146279968CSubscribing to /camera/image/compressedDepth/parameter_descriptionsL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosoutN conn=op=5topic=/camera/image/compressedDepth/parameter_updatescallerid=/camera latching=1'md5sum=958f16a05573709014982821e6822580hmessage_definition=BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent type=dynamic_reconfigure/Config& conn=op= time=4Sykl png_level  depth_max$@depth_quantizationY@DefaultI conn=op=0topic=/camera/image/compressed/parameter_updatescallerid=/camera latching=1'md5sum=958f16a05573709014982821e6822580hmessage_definition=BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent type=dynamic_reconfigure/Config& conn=op= time=4SL_ jpeg_qualityP png_level formatjpegDefaultN conn=op=5topic=/camera/image/compressed/parameter_descriptionscallerid=/camera latching=1'md5sum=757ce9d44ba8ddd801bb30bc456f946fmessage_definition=Group[] groups Config max Config min Config dflt ================================================================================ MSG: dynamic_reconfigure/Group string name string type ParamDescription[] parameters int32 parent int32 id ================================================================================ MSG: dynamic_reconfigure/ParamDescription string name string type uint32 level string description string edit_method ================================================================================ MSG: dynamic_reconfigure/Config BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent *type=dynamic_reconfigure/ConfigDescription& conn=op= time=4SfSDefaultformatstrCompression format{'enum_description': 'Enum to set the compression format', 'enum': [{'srcline': 9, 'description': 'JPEG lossy compression', 'srcfile': '/tmp/buildd/ros-hydro-compressed-image-transport-1.8.21-0precise-20140617-1549/cfg/CompressedPublisher.cfg', 'cconsttype': 'const char * const', 'value': 'jpeg', 'ctype': 'std::string', 'type': 'str', 'name': 'jpeg'}, {'srcline': 10, 'description': 'PNG lossless compression', 'srcfile': '/tmp/buildd/ros-hydro-compressed-image-transport-1.8.21-0precise-20140617-1549/cfg/CompressedPublisher.cfg', 'cconsttype': 'const char * const', 'value': 'png', 'ctype': 'std::string', 'type': 'str', 'name': 'png'}]} jpeg_qualityintJPEG quality percentile png_levelintPNG compression level jpeg_qualityd png_level formatDefault jpeg_quality png_levelformatDefault jpeg_qualityP png_level formatjpegDefaultE conn=op=,topic=/camera/image/theora/parameter_updatescallerid=/camera latching=1'md5sum=958f16a05573709014982821e6822580hmessage_definition=BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent type=dynamic_reconfigure/Config& conn=op= time=4Sב{ optimize_fortarget_bitrate5 qualitykeyframe_frequency@DefaultJ conn=op=1topic=/camera/image/theora/parameter_descriptionscallerid=/camera latching=1'md5sum=757ce9d44ba8ddd801bb30bc456f946fmessage_definition=Group[] groups Config max Config min Config dflt ================================================================================ MSG: dynamic_reconfigure/Group string name string type ParamDescription[] parameters int32 parent int32 id ================================================================================ MSG: dynamic_reconfigure/ParamDescription string name string type uint32 level string description string edit_method ================================================================================ MSG: dynamic_reconfigure/Config BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent *type=dynamic_reconfigure/ConfigDescription& conn=op= time=4SңDefault optimize_forint3Try to achieve either 'target_bitrate' or 'quality'h{'enum_description': 'Enum to control whether optimizing for bitrate or quality', 'enum': [{'srcline': 9, 'description': 'Aim for requested bitrate', 'srcfile': '/tmp/buildd/ros-hydro-theora-image-transport-1.8.21-0precise-20140617-1549/cfg/TheoraPublisher.cfg', 'cconsttype': 'const int', 'value': 0, 'ctype': 'int', 'type': 'int', 'name': 'Bitrate'}, {'srcline': 10, 'description': 'Aim for requested quality', 'srcfile': '/tmp/buildd/ros-hydro-theora-image-transport-1.8.21-0precise-20140617-1549/cfg/TheoraPublisher.cfg', 'cconsttype': 'const int', 'value': 1, 'ctype': 'int', 'type': 'int', 'name': 'Quality'}]}target_bitrateint(Target encoding bitrate, bits per secondqualityintEncoding qualitykeyframe_frequencyint#Maximum distance between key frames optimize_fortarget_bitratequality?keyframe_frequency@Default optimize_fortarget_bitratequalitykeyframe_frequencyDefault optimize_fortarget_bitrate5 qualitykeyframe_frequency@DefaultS conn=op=:topic=/camera/image/compressedDepth/parameter_descriptionscallerid=/camera latching=1'md5sum=757ce9d44ba8ddd801bb30bc456f946fmessage_definition=Group[] groups Config max Config min Config dflt ================================================================================ MSG: dynamic_reconfigure/Group string name string type ParamDescription[] parameters int32 parent int32 id ================================================================================ MSG: dynamic_reconfigure/ParamDescription string name string type uint32 level string description string edit_method ================================================================================ MSG: dynamic_reconfigure/Config BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent *type=dynamic_reconfigure/ConfigDescription& conn=op= time=4S/@Default depth_maxdoubleMaximum depth value (meter) depth_quantizationdouble=Depth value at which the sensor accuracy is 1 m (Kinect: >75) png_levelintPNG compression level png_level  depth_maxY@depth_quantizationb@Default png_level depth_max?depth_quantization?Default png_level  depth_max$@depth_quantizationY@Default& conn=op= topic=/rosoutcallerid=/camera latching=1'md5sum=acffd30cd6b6de30f120938c17c593fb7message_definition=## ## Severity level constants ## byte DEBUG=1 #debug level byte INFO=2 #general level byte WARN=4 #warning level byte ERROR=8 #error level byte FATAL=16 #fatal/critical level ## ## Fields ## Header header byte level string name # name of the node string msg # message string file # file the message came from string function # function the message came from uint32 line # line the message came from string[] topics # topic names that the node publishes ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id type=rosgraph_msgs/Log& conn=op= time=4S:64S|/cameraCompressed Depth Image Transport - Compression requires single-channel 32bit-floating point or 16bit raw depth images (input format is: bgr8).w/tmp/buildd/ros-hydro-compressed-depth-image-transport-1.8.21-0precise-20140617-1547/src/compressed_depth_publisher.cpp!CompressedDepthPublisher::publish /rosout/camera/image/compressedDepth4/camera/image/compressedDepth/parameter_descriptions//camera/image/compressedDepth/parameter_updates/camera/image/compressed//camera/image/compressed/parameter_descriptions*/camera/image/compressed/parameter_updates /camera/image/camera/image/theora+/camera/image/theora/parameter_descriptions&/camera/image/theora/parameter_updates* conn=op=topic=/rosout_aggcallerid=/rosout latching=0'md5sum=acffd30cd6b6de30f120938c17c593fb7message_definition=## ## Severity level constants ## byte DEBUG=1 #debug level byte INFO=2 #general level byte WARN=4 #warning level byte ERROR=8 #error level byte FATAL=16 #fatal/critical level ## ## Fields ## Header header byte level string name # name of the node string msg # message string file # file the message came from string function # function the message came from uint32 line # line the message came from string[] topics # topic names that the node publishes ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id type=rosgraph_msgs/Log& conn=op= time=4S˘4S|/cameraCompressed Depth Image Transport - Compression requires single-channel 32bit-floating point or 16bit raw depth images (input format is: bgr8).w/tmp/buildd/ros-hydro-compressed-depth-image-transport-1.8.21-0precise-20140617-1547/src/compressed_depth_publisher.cpp!CompressedDepthPublisher::publish /rosout/camera/image/compressedDepth4/camera/image/compressedDepth/parameter_descriptions//camera/image/compressedDepth/parameter_updates/camera/image/compressed//camera/image/compressed/parameter_descriptions*/camera/image/compressed/parameter_updates /camera/image/camera/image/theora+/camera/image/theora/parameter_descriptions&/camera/image/theora/parameter_updates7 conn= op=topic=/camera/image/compresseddcallerid=/camera latching=0'md5sum=8f7a12909da2c9d3332d540a0977563fmessage_definition=# This message contains a compressed image Header header # Header timestamp should be acquisition time of image # Header frame_id should be optical frame of camera # origin of frame should be optical center of cameara # +x should point to the right in the image # +y should point down in the image # +z should point into to plane of the image string format # Specifies the format of the data # Acceptable values: # jpeg, png uint8[] data # Compressed image buffer ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id type=sensor_msgs/CompressedImage& conn= op= time=4ST4SF}imagebgr8; jpeg compressed bgr8TJFIFC   %# , #&')*)-0-(0%()(C   (((((((((((((((((((((((((((((((((((((((((((((((((((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?㊅U++99N;Q^CNS"FGT<RtӥH)P)h'JJZC@”RQ@) JZcRRRJ)Ri)E'z)š 8S”SsNE/QEM-< pS-(F(R(QIHPRR(8UE4JhJu%9)ƑiؤRSz3M"i1@J)ZhARF"!Z`PRRS #~}ҴYt99? ]üٿԁqUy*ĕVN%)J?5D MƋ17"D՚Vzp f@"@DRMARcҀE-CMm (ZZm8RE- E- ZJ)Rii3E(J@/zpS(8uQES6NҞ(GJu RK@(\O-RĢ4S4i1Ҕ/JSHCZ)EJu1 <@Sifi(@17="ԫQ-JjUԫ@AKL4@F+6a iݬl9Y}g?uYF?RqU9z(st53g?=F ,|yL HUS[glZ⹻yvNmb;h#(LCh-)CLbb Z(bZAK@Q@-%L ZZJ)`.iAњ@?4j<҃@Z4h&hUրM@ZZ QK@ HiأJu6 HiƚhN)sH`i -4E%OH(4JM4Pi(3=z@J2+S%1-JV$^PHiM!m?J~}M!B]gme\}vZ<5g B8zU9zV.|,$$1ԥf$ɦJQ*\e&mP bNQM(ԥ0)0]/&ypI+7ߩ=^n$=}.^POj#}MȨD*ʤt'8i"'ʽVAN?:~+Y$DVWs@Mחg ,#Mw~@UcޱU wskUQN)*P8LTqM"B)4bec\P &)Sq@.(PxLP1)@<- P)إ3PdPE?b#F()1@XJwj(4 px h=M4 z`Ti?,GvqqKA?m[۴z+-J&K5V/DƼ'*U=CbD /L%8#X?:<$L>PgK)*S8E}iPz<|)!"*MW>IczQ忡dDzPKOI[SqS4o[q*`PS7[cB)[} 8 ]Ӏ\R0(?(⒐LsOQqN4R h 8i)@ZiR-0)hLPRR@ ;RPES) .i)M4M4JSM4jfiQ\3K!J4x4rrv 7ҹxp#Ɲh ZRXF`ӽ(ӱF1KJfgE/{}:ҥq`ߝG.Ҁ /UE;`awz Q8{O5J( IQKSJzj]p0FqA-Si7]=SkyzRӼ4sSHZnd7 q[ Sw UPq_2RMRrkL v(p3DON^ߊ֎)@ 1?ZS.T5J+3H1Qsnj?֯K.dRωR}~?ƥ?m ׫J\J.Ȅxٱ"\x`z .?'Տ()ϏK})vJ.AS3]_J>scF@Ev@*qΑ}>7i 틁R_J.ă?Ťcp?œ0U-K寧] 0w^7?)})| mgu) x:^~R+EƘ>œN>(ԣĚ1?V뎃uV:Htc/4$~"j|ʿ'.o!?}hҿ4l=b߰ßQ"7X鎱gF}\S1 _+/R>Q:oM45 SZyiWkͷ{| Oco :}jӖrMhHtoZ.mKcmWh2ssIr_v)?{ w4'=#rO!O4ip~t\BHB3mR}~_CSp:yyIθ=n?1I>}N@#zfOWɤ9]vO=/$.=E!yS2fvQTAiMR6:8I4&cD2c[&*O7^Ld&xTk~Oj)N5=Loʑߕyaux}~_AcҥRCVVӑ\QA{#O!`|]eUi][ovp@NCcT'BZDyĖ!纋NE(PE fJ))sH)h–)LSS ()ERJ(K@ŠZ(8RREQERJ( )E.)q@X)h\PbK1N 1@ZR(H'*(.(-7bI@ 1K(RP1>P1@Qf(;P!;Ho4QLFu!iQu7ѶE; aIaOP)Xh`_aKg(HPRAK Z(PIKEE8RKҀ)i(8 Jp(F)h Z(()- pZ(1J-.(-.(4SK1N{ (P.(-%-.(%(\RE;@ LPQNPhbPhF({@ bKKI@JBIJZ)q@Ģ}()q@aNS$;j)i( S)hԴp)N)EH)E6HSIK!RZJ0-%- @KH1K@ KMPKIK@ J))€NJRRA(@bZ1KB%.(P8c&)E))hQERP (bQE QIJ(iERc9;CQJH--&GLi/Hc%?:7QL,: Ac(R⁊(ZQE(恊)’@Q@–S \RP)p `QHaJ(8P){ҁK .)q@)h; AN)ؠV pP;((Z6SFaҊpZ]^mRKKK1@ hSF() e1@ ZBO?x~TPN"#Re- ֟0KڌQ@ KHrsjMZLSel;z0KHOqNրP)2(ޣ(h[0-/.0mu-" ?mk= Ʌ{n`q5 ]`]s{,Cנ]mTSMh]{_"k'TuXbc6#Gc)>$JRx7x>$~)h}?? OG!f?MH4RLe}Կz/Rb:P5zO]8ԗrT) !wE.Oi&1UE-Gf3L3G4W /zCnt`Dۃ?hꚐCZZE8XS9~HQ):TҊ@*-xQt?ƥ 1|GuΛ'TS mbm<#:s[+<ik65T(ӭfӳ5;>ɥ-TSQE!tI\L} %s>fd:/=lH%?֣m/WPInu]m~f&bx|BTA2ZjQN]QweL۳Ɵ$UOS/hjH:>ۑhQ:F O?OQ? $Uf]d8 “I g/Uğ5<o* 7V?=X6?Y49_xԤ?w:xƋ.'C_76 >R5 m\}#3)Dj"q_ȏ3{ю촿n \9§K"|MvXR _ ė"?҇4}_Bqca)> /=Aso}D+Hz3Ja"-5@m@33'HMgL'%Q6WǛ34c=2š׶20k4Cc⩆sh?#o2oJڅuݷs*EYić⩅C?~ _U+y7'PǯH5m15]Ƽ뵮<6zESdwnwtīO[b0'SOEdN٪o2g|$'EPO=EBȖ#D?!K>eꨒpߢxE׸^c3sh8(ڕC,?ٸt 7U;K\&icFFE'SW=O&igXc29?]G5E LP(v &( _(RKIJ(E8RwS8P)hbpzG;EJ<*qiyϒf PoHOmFG;;#Y|M9IO^ ےq?X-麒*6c'Tt$8SZCdyg+mu3CQe?<ȝJ5?u7pOUY')O G|5~}03No={ ӢFtp>_#(Az?>ZYڞ|W#Ǽ#)VDŽ?|1ӿdů-m"ѱO8Y}v*V@o5ymss^N=?q_6Vܥ~T{H*N};jV<QKAq7:mY۸STƱ9ͥ3`]'R ^؞ [pӭpae>v£:u6V)Ÿ:]E4Þ$85ORgs?R]g,)?jdOMJ#ƼtL}0-hv_3ч|6 GNN2_^pe CpSi!QQλ/sƥ ИqzKa^olCJ420ev_3'*QM!\B1=LNӆ2ԗG:/G8Y#|Z=Td?=fG4Gza&h>H̯6]:`ֺ3Q)z~:r>95I7g#z4 s\r?O757lis!rp 캹S8_Z]B/SjzZI/Ah >F|nz^܏Ɠxv\V"Oz0FyMN7?ߢVsKhƣqLR js9 Ht Kiُ .kɏO$C4jbߡFiw%>GH| qA쩃U;_jC?1OFiw|u:[ʐUjxa{6#RǧGIEM'G!}R"DUF׉sԬl*ZܷF5;ƚ|F؟Ʃ>Ԭ>+SƣdWAiw/j#aivR?5|M^ot޿d82d a:,5>AkV) hO ˿/˱Ҧ˲CYoxOq?ZHZ8)?<@VK6^*h5|-l<|D3fOE𯈲 [ F6\E,hr}}“Ο]PI-O@~זILvu< wRt߈F?_n#1p_=k??MD?K#wA@> 5evZ vqDDCoKQ7mP9Η]tHt]hrt o8u.;6-C=~_ߎ*|M'IȍY7'YAr]T1dhY^/Y:ĭB˓id*lv2ΗĮA*kZ0Z>>Qy#_eW}N[Xqҷ.Ү+[_vxj=zXqYŤrwgD.Xk5܀8ϤjZ⺴D[1>`P%_6^tmme:)摥5ơ *pYje3:veq6W#-q\ZN$|B*/3M"N0)pؠ ShM} Cg7 eRҐYkiGoR}r|EFZw Ǽ7E)Tflg ¢e"LcSdjĽR!Q$Nah&W&2>1뒻z}Λ6p6\BhYNz@+bPԶA&rrK3=iLj@j,aUВe> [UzK(%9=p^>AeqW4 }#ONP0H}M D; P0; 4- YsTWW9E?N+Oi!4һ#ڻcKsǁ"V+!MqOb7-5^ۓV^ac\ޱ֘ubO75pIθ!tQT}xV{OqԟXn#۟r*Ӳ!Gֹky5mgiT!Cs@ԀTj8PSPeMH)*T*jQҚT5"HjQL HJ(THQLv(6)(RiaMjyMR1PYERu 8⥁x:5jn_Sv> hAҨnZ0qT!Nq2S:Uk7[ ʪ@]Gm\wpW1_>YZ+$Kf FA sgi4հH"fhc]XjpfRخxU,{zTGnxC-t}?Y'}@:Vu[wT]yy&/QQTRL(4/J s:Mt5GO7H^ܞ ܦk4 ksSGqWJPI欃Y0J2+F7 3IvV%?-T?=X@ njALǭfݷ {8# \mj7}D`s+>ta }'mcm0"MhZ΢[VȬZF⳹eڦV5XSTZ5T>+6 iDիµs^*6:yj} p}OiܙnF}IfCy_IfS7k=1ػ٬5vݹLB3N!4*WzJ)RJyj5<5B 8."` Np-,*RV "TFU j}*U5YC@M@ JZ{T ֦^ &J*uˉQXe 9;Zry8 W`ݕQr3s'+HWU@"x88 קhWND ֳDډ5Qڞ+ːZCU0"5]Mp~jq&3@Oو p=R= 3/Vx\ؤլl0׷$}#p>F0-+|wPqjջsT՘OI2x9Q[5`Bxޫx j,K|7$g8QV2\\*ڮ3O45#Ѽ-GsHdO+xb8U<x»[e%̠?˾<6=R3\Wylǰ뜚PZ29ҽ#MQz(+Y݆E(r+I+AW#zm.KoqV-Z qֹm9+q ՙt5-Y͜Eg-yj+u؋ןϚ|I1MY z渘Td ҚЉt^7 =],DG0 nJ:Rԥ1Vu E3fݸX6@$VoU5;) rj<ӥ?52 6\`҃@&L4585EJ L 9Z .F$jfbjd CW!nPўjg4e5j*j*S%B*d i=)M!i4! 4ҚkRj&js 櫻Ԓ Sv!=Tdc#V;*ɓ֛tƪ5, ꒹@[ OSTÚ7 jgV!zTjhCҭ%TVҘ5SJk)Jsuw5j@ZErt>7Y#QLRQZ3IFGz@;4f}i7@TR+Up➮=heMMbfV/#dU[ωVj`iYCҨB*G`\CVtn1S%CNKI@4N4@CN4Ҁii#v54*4S皷) RnE!U UH 7uPUUVAH `ujxa@#|5SUd=i y*OXM ǩAUcTU?+W!̿Zokמ>/J%̄LP(D 0N?7ҠSan{VֹyBO&ƁsƷ 8 pq޸K+, #5%^Y>rՕr|LP#m?Þ*h6꿢$Db@XJ~U-{9Qj~pGϕ-4u+KlۯyNO?V]k59cQb:MʚLFVuvҠXMS޻E(Z0sG+10c)sMw ֖3eOPdrk8UJ-'0NGe9FkU2T1U (4NPM0Ӎ0)zUvUހ Sc[GCUd5bCUd4v~z}~mMvEVK7Pz90j|T&hZ7正fa_+1cj5f3@sW"c5n&lGRo% Σ$L1\ׄWF:ЄsODJ:[e/ Ti*)4 FvԛRvlT֢=j 6qRLEmML= \)XSeԈ jϻ*o%5gu gva%Ku'WSSFoW#l2AN[zӸhܷrWϛVјcWʜN< ?>сX79Qȡ N?rt#2>I֚ϵ8h#(lHc#g!h CHd B) ^֩x@KoSۥWc6_z4@ }袂hbqjӷ< =-[φ .ryfW76Eϯ;TZ/M^ٟ[A fDv05j)&)I"L cRX)O..ߠkM%!Y;8p|FngBO*3ufTjYKEiT⹟TSCPu B SR@ ML#G PqE5~tGS|2̾tԻDjT;En9V xUĊqU%34C?0N4*A2ȡ_R- ĖJH[-+ ZS8:UU*Uq4CMjqi a5=6Ԇh]jPqjrQ"ثRru#NL"wm+GSa&z{j/U} z Ҍg};C/4!I*xavޞ CkxTݥ"Fr# AǵAhҺ!3s0 ?a>7WUHҺ/F ̹?cX#EH!@3 ?yڃ^Pa(h){ ~MVʟ zjF;1i_w B9*/h=/c>?c8<GTdUh!]G52+Fw)jR_N24ق0: ]sҸ{N$Ԗڴ ^ǨxA^Kua?Z=q[ ֚%sN\RC[es<5qGL#ޮ/@tsֆ:> &OִA4 Z=+'vKDK#EɮL]:&X7Rn~Nnڪoد8/b:סirQ:}I:ƛ+E )b#ƭ$M֢J($;;nbI(Z/CHcpp8KcEp&kՇP-`@ji=.;B Ӿ|աiNv x~G=@qj~hd⋅$u*{3ͣ~LyG };N`T nj-Yո[hFjhzUQ`!l\\Z]iu5VRktG*zwVD|+dd+'crRw鴧;*Zyo&q?oiOji !HhRc bj6) jQN Ұ5FqК\rPdOYu?CZ7Y?ʨʮ>j[aENټ#z/s=9,Wp[ӆnTUP}z0fuĻ]>^nGahd@H\᫚=v HHRSy5LuiV.mpk"g!npkz1ո$e.A[0`9`Om[ W zv"Hʤ~cfl'Jy;Idqiv'PGӧf>m&60µ.ٯF ?+BI/dM, e?},]XZ-Jq@ =*ܟPiYD=i!z$ߵIo08 q&03UA EKM4BuIߪro\~fMH}ګAV3LRRHӈ&(Rb @ 3Jƴ-LfnMlU䱖hbʼ#?Zzm*ـִ{d~"=ncS/t+= `G"⛥G5үAY-ʬ2j6>9U f5`2OKD3¸K}NY ~sٽ2vW+߱K|Â,p,({U#X*:VN>ٙdNz'<;0\AޔqM.\JOCSSҕM*$42ևc֌۵QߴQ6+:d >򞢴⹄wIDuzVʁkD 05n ʆZ0Hzշ[g >i=}kJݨ7&PSo)#Zh6Fy7@6iƚhLjya8M!⫹&<'8ibLÚT&Pk.9=6Zxq =~y4͎֎?!say=-}3R)jvdVե_!Sl8/zWeMxt3C\fC]m\ҽ\*D'b|R.n;vݒ"ŋy&ǵtl W5hO[:.1Ң5ۡbT\g#5E{R+WC+(tfF#+1/v=j{j)S"R0x:msP,}\痱s]oʌ寣11kOݱu’Gğ7^V5\s_EԴ*UpOD.pwœ {{0^ q\ZȲ*r+k_> fOr ꣵy̶uĵdwmLZ^Yug UX*㓑\yM R%-,qbz<|":U=iؿÿt;:O_U =3 conn= op=topic=/camera/image/theora1callerid=/camera latching=0'md5sum=33ac4e14a7cff32e7e0d65f18bb410f3message_definition=# ROS message adaptation of the ogg_packet struct from libogg, # see http://www.xiph.org/ogg/doc/libogg/ogg_packet.html. Header header # Original sensor_msgs/Image header uint8[] data # Raw Theora packet data (combines packet and bytes fields from ogg_packet) int32 b_o_s # Flag indicating whether this packet begins a logical bitstream int32 e_o_s # Flag indicating whether this packet ends a bitstream int64 granulepos # A number indicating the position of this packet in the decoded data int64 packetno # Sequential number of this packet in the ogg bitstream ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id "type=theora_image_transport/Packet& conn= op= time=4S*[4SF}image*theora(|, conn= op=topic=/camera/image,callerid=/camera latching=0'md5sum=060021388200f6f0f447d0fcd9c64743message_definition=# This message contains an uncompressed image # (0, 0) is at top-left corner of image # Header header # Header timestamp should be acquisition time of image # Header frame_id should be optical frame of camera # origin of frame should be optical center of cameara # +x should point to the right in the image # +y should point down in the image # +z should point into to plane of the image # If the frame_id here and the frame_id of the CameraInfo # message associated with the image conflict # the behavior is undefined uint32 height # image height, that is, number of rows uint32 width # image width, that is, number of columns # The legal values for encoding are in file src/image_encodings.cpp # If you want to standardize a new string format, join # ros-users@lists.sourceforge.net and send an email proposing a new encoding. string encoding # Encoding of pixels -- channel meaning, ordering, size # taken from the list of strings in include/sensor_msgs/image_encodings.h uint8 is_bigendian # is this data bigendian? uint32 step # Full row length in bytes uint8[] data # actual matrix data, size is (step * rows) ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id type=sensor_msgs/Image& conn= op= time=4S".4SF}imagebgr8o{}nz|p{yozxoyynxxmwwmwwmxvlwumxvmxvlwulwukuuisshutivufvsdtqcspbrodqpdqpfppgqqhrrissjttkuukuukuuluxluxmwwnxxnywozxp{yq|zr}{s~|s~|s~|v}v}u~vxy|}}xs`psgwzrsv{~r}{q|zp{yp{yoyynxxnywnywmxvmxvlwumxvlwukvthushushushusgtrfsqerpdqoforforforgpsgpshqtirujsvjsvktwluxluxmwwnxxnxxnxxp{yq|zr}{r}{s~|s~|v}w~vwxx||xraqthz}pqtxy~r}{q|zp{yp{yp{yozxlywlywkytkytkxvkxvkxvjwuivtgtrgtsfsrgqqgqqforforenqenqenqforforgpshqthqtiruluxlvvlvvlvvmwwnywnywr{yr{yr{ys|zv|{v|{w|}w|}v}xzz{|~~~xq_pqgz{oqtxx{r}{q|zo|{o|{n{yn{ylywlywkxvkxvkxvjwujwujwuivtgtreqsfrtdrtbprbprbprcnrdosenqenqforgpsipskrujsvktwlwulwulwumxvoxvpywsyxtzyu{zu{zx|{x|{y|}y|}wxxyz|}|thuykx|rsvz}t}{t}{q|zq|zq}xo{vnywmxvkxwjwviyviyvhxugwthusgtrgsufrtcrqbqpbprbprcnrbmqbnpcoqforforhqthqtiruluxlwulwulwulwuoxvpywozxq|zpzzq{{t||t||u|u|w~w~u~wxy~~yrbqwdu{pquw|r}{r}{r}{q|zq|zozxnxxmwwkwykwykxvjwujwujwuivthusitrhsqdqodqodoscnrbmqbmqbnpcoqforforforhqthqtirukuulvvnwunwuoxvpywoyyoyyq{{q{{t{~t{~t||u}}v~~wxx|~~yn^qx^qxnrty|r}{r}{r}{r}{q{{oyylyxlyxlyxkxwjwvkxwjwvjwvivthushusfsqdqodqocnrbmqakrakralpbmqenrfosfosfosgpsirulwulwulwulwulwumxvmxvozxpzzpzzt||t||t||t||v~~xxy|}~yraoycq{rtvy}|u~|t}{r}{r}{q|zp{ymzxmzxk{xjzwiyviyvkxwjwvivtivtgtrerpbrobroanr`mq_lr`msbmqcnrcnrcnrdoseptcqsesufutgvujwvjwvlvvlvvmwwoyyox{py|r{~r{~r||r||t}u~vwzz|}}~~yr_muft|urux{t~~s}}r||r||p}{o|zl|yk{xk{xjzwjzwjzwiyvhxugvufuteurcspdprdpraoqaoq`mq`mqbnpbnpbonboncoqdprdqperqgtrhusjwujwulvvlvvmwwmwwoyyoyyq{{r||r||r||t~~t~~u~vyz}zq^oubtwptxz{~t~~s}}r}{r}{r}{q|zp{yozxozxnywnywmxvjwujwuivtgtrfsrerqdprdpr`mq_lp^ko^ko^ln_moamobnpbnpdprdpreqsfsrhutivujwvlvvlvvmxvmxvnywozxqz}qz}r{~r{~s|u~uvwx{|~~ytapvgxyruxy|{t}s~|s}}r||t}{s|zp{yozxozxozxnywnywlwulwukvtitrhqtfordprdpr_nm^ml^ln]km]km_moamoamobmqcnrdqpdqperqgtshutivulvvlvvlwumxvmxvnywpzzq{{r{~r{~s}}t~~v~~wz||~xrcsvj{|rtwy||t~~t~~t}r{~r||r||p{yp{yozxozxozxnywkxwjwvjvxhtvfrteqscqsaoq]no\mn]km]km\kj]lk_lk`mlamobnpcpndqodqofsqgtshutkuukuulvvlvvmxvnywozxq|zr}{r}{s}}s}}v~~v~~z|~yrdsyhx{pswz{~wv~~u}}u}}r}{r}{q|zozxmzymzylyxlyxkxwjwvivuhutgsufrtars`qr^op\mn\jl\jl^jl_km_km`ln`lnamobnpcoqdprdprfrthtviuwiuwjwvjwvkxvkxvoyypzzqz}qz}r{~s|u|v}y}{|~zshw}fvyqtwxxut~~us}}p}|p}|o|{o|{n{ymzxky{ky{iwyhvxhvxguwesudrt`qr^op]mp\lo^im^im^jl^jlakkbllbllcmmcmmdnndnnfppgpsirujswjswluxluxmwwmwwnxxoyyq{{r||r||s}}u}}v~~z{|~zsft|du{otxy{vu~u~t}q~|q~|n~{m}zn{ymzxlxzlxzlw{juyiuwiuwdsrcrqbqp_nm^ln\jl^jl^jl_hk`il`il`ilajmbknanmanmcpodqpepteptgpthqulsvnuxnwuoxvpywpywq{{r||r||s}}s}}uxz|}zsft|gv|ruwz|wvt{t{syr~xr}{q|zpzzoyyox{ox{mwwlvvktwirugpsforeoodnnakk`jj`il_hk_hk`il`il`il_lk`mlanmanmbnpcoqfosfosfmvhoxjswktxluxluxmvynwzox{py|r{~r{~s}}t~~vvz{|yriy|gwzrtwy{wvu~s~|r}{r}{r}{r}{p{yozxoyyoyykxwjwviuwgsufrteqsdqpanm`ln_km^jl]ik`il`il^kj_lk_lk`mlanlbomcnldomgnqhorhorjqtiruktwlvvlvvmwwnxxqx{ry|uz}v{~v{|x}~y~{{|~ztfu{iy|psw|}xvw~u~|t}{t}{r}{q|zq|zozxozxozxlyxjwvhwvfutetscrqcpoanm_km^jl`im_hl_hk_hk^jl^jl^jl_km_km_kmbkndmpenrenrfoshqujsvktwkuulvvluxmvyox{py|t||t||s}}t~~uwxxz|{tapvhyzqtwxyywvvt}s~|r}{r}{q|zq|zp{yozxozxkwyjvxjvxiuwgtrerpdpramo_jn^im^im]hl\gk]hl^im^im^im^im^ho_ipajnclpclpenrfosgptiruktwjsvktwluxmvynwzpy|q{{r||r||r||t~~wwxy|}~ztdsyiz{qtvy|}wvu~u~t}s~|r}{q|zq|zp{yn{ymzxiyvhxuhwvgvuctsbsr`qr\mn[knZjm]gn\fm\fm\fm^gj_hk`il_hk`imajnajnbkoclpenrfosfoshqtirukuukuulvvlvvpwzqx{tyzuz{t||t||v~~wxy{}xpdw~ey~nruyzwvu~u~t}r}{r}{q|zq|zp{yozxozxlywjwujwujwueurcspbqp`on_km^jl]hl]hl\hj]ik]ik\hj\hj^jl`im`im^im`koakrblscmtcmtdosfqugrvhswluyluymvynwzpy|py|sz}t{~u|v}yzx{}~{s`pzgxpsutxzxvvut~~s}}r||r||q{{pzzoyynxxkxwkxwhwvgvuetscrqbqp_nm]lk[ji[ik[ik]ik\hj[gi\hj[gi]ik_hk_hk`imbkobkoclpclpdmqforgpsissjttlvvlvvlvvlvvpxxrzzuz}v{~v{~y~z{}~zses}m{rruz~yuuvut~~r||r{~r{~pzzpzzmzymzyjyxhwvhvxguwesucqsbqp_nm\kj\kjYjkYjkXhkWgjWgjWgjYfjZgk[hl\im\im]jn_jn`ko`kobmqforforhqtirujttkuulvvlvvmvyox{qz}r{~r{~s|wxz|~yoaq{nppsvx|wwvu~t~~s}}r||q{{pzzoyyoyyoyykwyjvxhvxguwfutbqpapo^ml\kj[jiXijYjkXijXijWhiWhiXhkYilYilZjm\im]jn^im_jn_jnalpcnrdoseptfquhtviuwjvxjvxmvypy|qz}r{~r{~s|t~~v|}yr`nvlzrsvsutwvut~~s}}s}}r{~qz}pzzoyyoyynxxjvxjvxhwvhwveurbro`on]lkZklXijXijXijXhkXhkWgjXhkXhkYil[hl[hl^im^im`imajnbkoclpenrenrfosgptirujsvkuulvvmxvnywp{yq|zr}{s~|v~~w|}ytiwl{svxxzxwvuut}s~|r}{q|zp{yp{yoyynxxlvvlvvktwirueqsdprapo^ml\kj[jiZhjZhjZgkYfjYfjYfjZgkZgk[hl[hl]hl^im^im^imbknclodmpdmpforforgpthqujsvktwlvvmwwpzzq{{r||s}}u|w~y{zsiwj{ptvtvzxvu~u~s}}r||r||q{{p{yozxoyynxxluxktwjsvhqtfrtdpr_po\mlZkjXihZhjZhjXhkXhkXhkXhkXhkXhkZgkZgk\gk^im]hl^im^jl_kmamobnpcoqdprfosgptirujsvlvvmwwozxq|zr||r||u|v}yz~{uetzhypruzy|xvut~~r}{r}{r||q{{pzznxxoyynxxmwwlvvitxhswdqubos_or[knZjmXhkXhkXhkXijXijXihXihYjkXijZhj[ik\gk]hl_hk`il`il`il`lnamocoqcoqdpreqsiruktwlvvlvvnywp{yq|zr}{u}}v~~xz~|ufvyhz}pqtz|}xvu~t}s~|r}{r}{q|zp{yozxozxnywmwwlvvjsvirueqsdpr`np]kmYjkXijXhkWgjWgjWgjXhkXhkVhkVhkXhkXhk\gk]hl\gk]hl_hl`imajnclpalpbmqcnreptgrvgrvitxjuykwymy{pzzr||t{~v}xz}|tarse}}lpqsuxxvu~u~t}r}{r}{q|zp{yozxozxnywmwwlvvjsvirueqsdpr_mo\jl[ikZhjYgiXfhXfhYgiWhiWhiWgjXhkZgkZgk\gk\gk[fj\gk_hl_hl`imbkoclpclpdmqenrfosgptirujsvluxmvypy|r{~t{~v}z|}{q^psbzzmoqvwzvtsst}s~|r}{r}{n{ymzxlyxkxwjwvivujsvhqtfordmpajn_hl^gk\ei\ei]fjZeiZeiVfiWgjWgjXhkYfjZgkYfjZgk]hl\gk\gk]hl^jl_kmajmbknbknenqforforiruiruktwluxnw{py}tzv|w~yz}~t`ps]tvnrt{~xvuut~~s}}r}{q|zn{ylywkxvkxvkxwjwvjttgqqfppdnn_lk]jiYhgXgfYgiXfhWegXfhXeiXeiYfjYfj[el\fm[fj\gk[fj\gk\gk\gk^im^im^im^im`kobmqfosfosgptirvktwluxmvyox{r{~s|u~wx{~u`psat{nqt{|{vtsr~t}s|r||r||n{zlyxjyxixwjvxjvxhtvfrtdpramo]kmYgiYfjXeiXfhWegWdhXeiXeiXei[fj[fj[el[el[fj\gk[fj[fj\hj\hj]ji]ji]ji^kjajmclodnneooforhqtjsvktwmvyox{sz}t{~w|y~|zshw}fu{qtw}~yxwvt~~t~~r||q{{q{{o|{mzyjyxixwjwvivugsueqsdqpanm\kjZihXfhXfhWdhWdhXeiXeiXeiXeiZei[fj]fj]fj]fj^gk^gk^gk\hj\hj^jl]ik^im^im_jn`kobkoclpdosepthtviuwluxnwzrx}tzu|w~z||tivzfvyqtw{}~xwu~vt}r}{r{~qz}nz|my{jyxixwjvxiuwgsueqs`qp]nmZkjXihUfgUfgUehUehWdhVcgXcgYdhZeiZeiZeiZei[fj\gk\gk\gk\gk\gk]hl]hl]hl]hl`im`im`imbkobmqdosfquhswktxluyqw|sy~tzw}z|~~vfswfu{rtwy|wwvt}t~~r||r{~r{~nz|my{lw{kvzhuygtxduvbst^qrZmnXljUigVgfUfeUfeUfeUfgUfgWdhWdhZfhYegZfhZfh[gi[gi[gi\hj\gk\gk]hl\gk]hl]hl^im^im`hoaipcloforgrphsqlsvnuxpwzry|t||wy{~{pbwyctzptwyz~xwwuu}}t||t{~sz}o{}my{iwyiwyfwxevwesucqsbqp^mlYkhWifVheVheVgfVgfUfgUfgUehUehUfgUfgUfgVghXfhYgiZgkYfjZgk[hlZgkZgk[hl[hl[hn\io^ho_ipcloenqforhqtmruotwrv{uy~r{~t}wx|}{rcuxdu{psutvxxwwu~t}r}{p|~p|~m{}ky{hx{fvyhuyervfqudoscoq`lnZkjWhgUfeTedTefTefUehUehUehVfiUehVfiVfiVfiWdhXei[fj\gkZgkZgkZgkZgk[hl[hl]hl]hl^im^imajmbkngnqhormruotwqvysx{v{|v{|xz}|tdtwiy|qtwy~{xwwvs~q~|p|~p|~nz|lxzivzhuyhuyfswgrveptcoq_km\jlYgiVdfVdfVdfVdfVcgVcgVcgVcgWdhVcgWdjWdjWdjXekXeiYfjYfjYfjYfjYfjZgk[hlZgk[hl]hl^im`imajncloenqipslsvpuxqvytyzv{|v}y{vdquiy|rsvz{{wvvvt}r}{r{~qz}py|nwzkxwkxwhwvgvuftvbprbmq^im\gkZeiZcgZcgXcgXcgXcgXcgXcgXcgXcgXcgYcjYcjYcjZdkYdhZei[fjZeiZgmZgmZgkYfj\gk\gk\gk\gk]hl^im`koalpdprfrtktwluxox{r{~t}wy|~teuxgwzsuxyw~yyvu~s~|r}{r{~qz}py|ox{kxwjwvfwvfwvctuars`ms\io\gkYdhXcgXcgXcgXcgXcgXcgXcgXcgZcgZcgXcgXcgYdhYdhYdhYdh\ei\ei[fj[fj[fj[fj\gk[fj[fj\gk\gk]hlajmbknemmhppktrnwusyxu{zv|{y~|zsft|jxrvy|}xwvu~t}r}{r}{q|zn{zlyxjyxixwhwvfutdqubos_lr\ioXhkUehTdgTdgScfScfVciVciVciVciVcgVcgXcgXcgXcgYdhYdhYdhYdhZei[fj[fjYgiYgiYgiZhjWgjWgjXhkYilZjm[knalpdoshqujswmvypy|t||v~~zwerxkwtuwy{xwvvt}s~|r}{q|zn{ymzxixwhwvhvxftvdrtbpranr]jnWgjUehTdgScfTdgScfUbhUbhVciVciXbiXbiVcgVcgVcgVcgVcgVcgVcgWdhZfh[giZfhZfhYfjYfjXhkXhkXhkXhkYilZjm_jnbmqfnuhpwktxnw{q{{s}}{ugwzfu{qtwz}|xxuts~q~|p}|p}|o{}my{hyzgxyfvyeuxdtwbru_or[knXhkTdgTdgTdgUbfUbfUbfVcgTciTciTciTciTdgTdgVcgVcgVcgWdhVcgVcgWdhWdhYdhZeiZei[fjXhkXhkXhkXhkXhkZjm`imbkoflqhnslsvovyrzzt|||vhx{hw}quyz{yxwwvu~s~|r||r||py|ox{lxzkwyhvxftvesucqsanr\imXeiVcgVcgVcgUbfUbfVcgVcgTdgTdgSbhTciSbhSbhSbhTciTciTciTciTciTciUdjVciWdjXeiXeiXhkWgjXhkXhkXhkYil\io]jp`jrbltgovlt{nw{r{y{~tgv|hz}otvz{zyxxvt~~s}}r{~r{~py}ox|lxzkwyjvxhtvfqudos_lr\ioWflTciVcgUbfUceUceSdeSdeRcdSdeScfScfScfScfSbhTciSaiTbjTciTciTciTciTdgUehUfgVghXfhYgiYfjZgkZgmZgm[hl\imajmbknforhqtluxqz}y~}{sfw~exmswz{~xxwvu~s|r{~r{~py|nwznxxmwwlvvjttfqudos`ms\ioVekTciScfScfScfScfScfRbeRbeRbeRbeRbeSbhRagSaiSaiSaiSaiSbhTciRdgRdgRdgRdgTdgTdgWdhWdh[fj[fjZgmZgm[hl\im^jl_kmbnpdprktwnwzv{||}uft|exmtxz|~zzxywu}}r||q{{pzzoyynywnywlvvissgptfosbmq^imXeiVcgTdgTdgTdgTdgTdgRbeRbeQadRbeRbePagQbhRciQbhSbhSbhScfTdgTciSbhTbjTbjVciVciXbiXbiYcjZdkWflWflXhkYil[hl\im`kodoshpwlt{r{w~|vdrzfu{ruxz~zzxvus}}s|r{~qz}py|nxxmwwlvvissfrtdpr_lp\imVfiTdgTdgTdgTciTciSbhQ`fRagSbhRagSbhSbhSbhRagRagRbeScfRbeScfUbhTagUbhUbhVcgVcgVcgVcgYdhYdhZeiZeiZei\gk^gk_hlbhmciniotntyuz}y~}uizhz}puw~~xwxwvu~t~~r||q{{oyynxxmwwlvvkuuissfppcmm_iiYegXdfUbfUbfUbhUbhUaiT`hT`hT`hRagRagScfScfScfScfScfScfScfTdgUbhUbhUbhUbhXcgXcgUbfVcgTdgTdgTdgUehZei[fj^gk^gkbhmcingmrjpuqvyw|}}uhx{l}~rux{{~zzyyxv}r{~r{~py}ox|ox{mvyjwuivthusdqo`ml]jiYegXdfScfRbeSbhRagRbeRbeRagRagQbhQbhPbeQcfTdgTdgTdgTdgVcgUbfWahWahWahWahVcgVcgTdgTdgTdgTdgVcgVcgYdhZei]fj^gk_hl`imdjoiotmsxtz|verviy|ruw{~yxxvvt}py|qz}nz|nz|lyxkxwhwvgvudutarq]noYjkVfiScfScfRbeRbeRbeRbeQadQadScfQcfPbePbePbeQ`fRagTaeUbfWceWceWbfWbfUbfUbfTdgScfTdgScfUbfUbfWbfXcgZcg[dh^di^di_ejaglcjmdknipssz}y}tdsyix~rux|~{zyyxv~~r||q{{q{{oyylyxkxwhwvhwvdut`qp\mnYjkVcgUbfScfRbeSdeRcdRcdQbcQadRbePagQbhPagPagPbeQcfTaeTaeTaeUbfTaeTaeScfScfTdgScfScfTdgScfScfScfScfVcgVcgYcjYcjZei\gk^im^imbmqjuyv|~thv~hx{ruwz~yxxwvt}r}{r}{o|zmzxjyxjyxfwvfwvduv`qr\mnXijTdgRbeScfScfRbeScfRbeRbeRbeRbeRbeScfSbhSbhSbhSbhScfScfRbeRbeRbeScfRbeRbeSbhSbhScfScfScfScfRbeScfTdgTdgXcgYdh\ei]fj^gk_hlbkoktxsy~~tes{kzrtv|~yxxwwu~s~|r}{o|zn{ykzyixwfwvfwvdut`qp\mnYjkTefRcdRbeRbeSaiR`hQadQadTaeS`dRbeRbeRbeScfScfScfSdeTefTefSdeScfRbeSbhRagSbhSbhScfScfQcfQcfQcfQcfScfScfWahXbiYcjZdk]fj_hl`imgptox|~~verxn{tvx|||yxwwvt}t}r}{r}{q|zmzylyxjvxhtvfrtdpr`ln]ikVcgUbfQ`fQ`fQ`fQ`fU`dU`dU`dU`dT^eU_fU_fV`gTaeTaeScfScfScfScfRbeRbeS`fR_eTagUbhUbfUbfRbeScfRbeScfScfScfUbhUbhXbiZdk]fj^gk`im^gkgpt~vdpxmxs~vz|{~yxxvu~t}s~|r}{q{{oyynwzmvyluxjsvhqufos`ko\gkVcgS`dS`fS`fT^eU_fV_cV_cV_cV_cT_cU`dWbfWbfU`dU`dU`dWbfVbdVbdVbdVbdT^eT^eV`gWahWbfWbfQadRbeScfRbeRagRagVaeWbfZcfZcf\eh]fi`ho\dkfmv~r`nxkyqtx||yxxxvu~s~|r}{q|zp{ylyxlyxjwvivuhutfsrdom]hfXadT]`S\`W`dX`gU]dV]`Y`c\ad[`cT]`V_bXbiWahR]aT_cT`bS_aUbaXedUceWegS`dR_cR_cS`dXcgWbfT_cVaeWbfU`dU`dU`dWbfVaeWbfWbfYbf[dh_gnemtls|}udsyl{ruxzw~yyxxvu~s}}r||q|zp{ynywmxvlwulwufrm`lgYf]S`WNYWLWUOWWNVVRWZQVYSUZUW\VX]VX]QUZPTYNW[PY]OU\PV]SX[RWZSX[UZ]SY^TZ_LV]LV]MX\MX\S\`PY]PV[OUZMVZQZ^QZ]OX[Q[[PZZR\\S]]U]]U]][^_befmsx|ugwzjz}ruxyv}wwvvuss|r{~r||oyymwwlvvlvvjtt_keS_YKSMFNHJJJLLLNKMNKMOJLOJLPHMMEJPGNRIPTIOSHNRJOQINQINQINSLNSLNTJMUKNNKOOLPHMPHMPJORFKNOLPPMQRLQQKPSLNUNPVOQVOQVOQVOQSQQUSSOTULQRGIMSUYlns~xmx|my{vx{|~zyxxwus}}r||q{{oyymwwoyynwu`igAKE3=7?FBCJFFHMEGLDFKDFKCEJCEJDFKCEJCDLDEMDEMDEMGEKFDJFDJGEKGEKGEKGEKFDJ@@ACCDAEDAED@BF@BFDDNDDNGDMFCLGDMGDMGDMEBKHENIFOJHNJHNIFO85>10=FER\bi~ubosjt{ux{{zxxwwus|r{~q{{oyymwwiss`kiS^\EKJFF>FF>FF>FF>FF=EE=EE=EE;DG;DG;EE;EE=EE=EE?ED?ED@CD@CDACGACG?DE?DE=EE=EE;EE;EE?DG?DG?DG?DGBEFBEFCGFCGFCGFCGFAEDMQPV_cajncjsucrxiwswx{}|zxxxvt}s}}q{{pzzoyylwuWb`NWUAJHBIL@GJ=FIEH=DG=DG=DG;DG;DG;DG;DG:CF:CF:CF:CF:DD:DDCF=BE?DG?DG;DG;DG;DG:CF=DG=DG=DG=DG>EH>EH>FF>FF@FEAGFEJMW\_`frekwelu}ufvyarxtwwz|yxxwvt}s|r{~r{~nwzionNTSEKJBHG@IL>GJGE>GEAGFBHGTZY]cbbko]fj[cj|sdu|du{svxy|yxxvvt~~s}}t~~u~|gpn`b]IKFJJJHHH@HH>FFFF>FFCKKZcf`ilclpZcgdjo|ues{fw}rsvz|yxwwus}}s}}vmuo]e_SVNHKCGGGFFF?DE?DE:GF;HG:GF:GF:GF9FE9EG9EG9EG9EG9EG9EG;EE6=@9@C:CF?9BE;DG;DHB;>?8;<5987;:;A@?ED>FF>FF;FJ;FJ9FJ9FJ8EI8EI:EI9DH=FJ;DHENRT]a`imfoseoofppfqoZec\eh~ses}hv~uxx|}~yxwwvmxvW\W?D?CHCGLG>GE9B@2>9/;63<:7@>:BBEH=CH>DI>?G<1:81:82;97@>9AA;CC=CH=CHB7BF;FJFORHQTJSQJSQ@IGDC9>?3892871763986<;9AA;CC=DG>EHNQHVXM[]KTWMVYS\_XadL\YDTQ?PQ=NO:KL9JK;FJ:EI3;;199.88.88/993==6?B9BE:CG;DH=FJ>GK=FJ=FJ=FJ?HL?KMCOQGTSKXWKXVJWUMXVMXVOZXP[YM[VKYTGWTDTQBQP>ML=IK;GI:FH:FH=FJ=FJ?HLAJNMU\]elbkndmphqohqohpphppkotbfkfhrxku}o{uxzz~|{p{yMXVDPKCOJALJ4:9389278,66-77/8;4=@7@C8AD:CF;DG;DH=FJ>GK>GK>GKAJNGPSMVYMWWMWWLVVKUUMTWPWZQZ]R[^P\^O[]J[\HYZEVW@QR=KM:HJ9EG9EG=FI?HK?GNLT[\ajfktgoogoohqohqohqohqolqtafihksvlv}o|uvxy}qzx^f^I:?J;ELHCJF@FE9?>598265265265-64-64.883==5??7AA8AD9BE;DHF>9A9KNFVYQUSYVTZTVZUW[SX[W\_V]`U\_Q[[NXXHRRBLL=GG=GG:CG@IMW]d^dkcinflqfqofqofrmfrmirpirpiqq\ddktx|ugu}lzrvx|}~`kbGRI=GACMGAII?GGEKJBHG?DE:?@8:>57;359248056056-64.75.971<:4>>5??6?C9BF;DH;DH=FIBKNMXVJUSCLJ5><99:334><JLFQUT_ccnralpcnldomhqohqohppiqqiqqjrrgpsW`clt{p~drzkyruxzzCHCGLGBJJ>FF7??-55137248137359.75.75+64+64-691:=3A7@D7@D8CG9DH;GIAMOM[VESN=ID5A<389.34-/3"$( "&=?COYSMWQ@HB.60FNA^fY_hdR[WBMK@KI=FIBKNS[b^fmbkoclpfnnfnnhpphppiqqjrrjrriqqiotU[`mq}phx{o~tvxzzBIEDKG?HD;D@3><)42)20+42-62-62-64-64,53-640882::4>>5??5??8BB9BE;DG>IGEPNVb]DPK8CA2=;287.43111######AAAW]\LRQ>BA! 888ZZZSYXKQPENLAJHDMQNW[Yahdlsbkoclpgnqgnqgnqhoripsjqtjqtipsmqv_chmsz}rfu{m{rvx~EIHAED1:8,53*22*22+33+33,53-64,53.75.881;;4>>5??5>A6?B8AD:CF +)38;?DGDFJFHLDILBGJOUZ`fk_hl`imbknclofmpgnqforgpshqthqtgpsgpsiotekprxyjt{iwtuvz|AGFA5>A6@@9CCIG*3/!*&4:9?ED?HFAJH@HHFNNT]`ajmajmbknclodmpgnqhorhppiqqgqqhrrhrrgqqgnqcjmr{yhryft|vvvy{AED:>=598043/32/32+03).1.-10/3223334.43.43/771993A5>A8?B;BE?DEEJKNUXGNQ:=D@?KFAMHAJMOX[Zbiaipajmclodmpdmphorhorhppiqqkpqkpqlqrlqrhppbjjp{~ueqyiwuxx{:@?5;:-64+42+42+42)11'//(-0*/2-25-25+25,36,5809<3<@5>B4=A5>B7=B9?D=AFBFKGNQNUXKRU!(+(22<74==:CEEFAAB8<;%)('+*0439<=ADEAIIFNNMSX\bgflsekrcloclodmpenqhpphppjopjopkpqlqrjrrjrrforclot|}shv~hv~vwy{}4=;097,53*31*31*31*/0*/0+./-01.12/23-25.36.661993==4>>4=A3<@8;C97@EEGKRTX^bg\`e?IP!+2$()'-87;@?C=EEBJJCIPV\c`ckcfnbilelofmpgnqgpnhqohpphpphoripshrrhrrississeoodnn{|thw}q~vy{x}.58+25-32-32+01+01+03*/2,/0+./*/2+03*14+25-4718;2::4<<5A;@CAEDHLKVZYY]\S^bLW[7GJ,=>KJ;FD>IG;FDCNLLRY]cjdhmdhmfklglmenqenqenqforhorhorhrrhrrhrrhrrhqthqtenrclp}rhw}jz}txyx}-64,53,53+42*22*22)11)11)/.)/.)0,+2.,21-32.660882::4<<7<=8=>8=@9>A;?>=A@???CCCLPOY]\P`]VfcH]_?TV6QU7RV;ZY5TS8NL7MK?IIHRRY`c_fibjjdllcmmdnnenqenqenqforgpshqthrrhrrisshrrksslttnuxhory|tfrznzy|}*53)42+42*31+01+01*0/*0/)/.)/.(1/)20+42+42-551993;;4<<5==5==6=@7>A7>A7>A:?B9>ADDEXXY]a`Y]\MWWKUUK[XO_\O`YCTMAMHAMHGPSR[^bhoekremmemmdomdomenqenqforforgpsgpshqthqtississitrkvtlusmvtubnvmyzz{}-32-32,12-23-10-10-10-10,0/+/.*0/*0/,21-32/543983<:4=;4;>4;>5A88=@8A+03---BBBMOJac^bfeTXWKNOGJKEHPLOWV\hflxclobknenlfomfomgpngoogoohpphpplopmpqmpqnqrrrsrrsrrsrrsnmqonrxlt{w~}}~-32-32/32.21-10,0/-01,/0,/0.12/15026.36-25-2316738949:79=79=8:?9;@:;C;AEDFGOBCKNOW]^fdgoehpejkfklglmhmnionioninoinojopjoplopmpqmpqmpqqqrqqrrqutswnpunpuwjryr}zyy{|.43.43.21/32-25-25-25,14,14,14026248138/16,1427:4;>4;>4;>4;>6:?8+8<*7;+8<,9=,9=)6<*7=*6>)5=+7?+7?*5@'2=(6>/=E1AD1AD1@F1@F3@D4AE6AE6AE6DF7EG1DE)<=&(-25ACMDFPFLQMSX`cdnqrlllnnnmmmkkkmrsinognqipsgnqelokonjnmjnmnrqqutmqpnrqnrqrvurvuosrx|{|tn{q~wwy{8JG6HE=MJ;KH8HC9ID4FC6HE9JK8IJ6GF5FE5GD5GD7IF9KH;LK;LKQR;NO;NO>QR@STEXYBVTON=NM@QRARSBTWASV@PSDTWIWYDRTARQARQ?USBXV=WW=WWAYY@XXCTUEVWMUUOWWWWXWWX[XZ\Y[ZY][Z^V[\W\]W\]X]^Z\`Y[_]\`]\`b[\b[\f[\g\]h]^i^_f^[f^[e^_aZ[b``eccbbbbbb``aaabccdkklhlkcgf_hfbkihnmgmliiikkkooooooppqoopnnoqqrsssssstttuuurvurvurvurvurvurvutxwvzywwwxxx{{{}}}~~}umwp|xxxz|HORGNQHORHORHORHORHORHORHORHORIPSIPSKPSKPSJORKPSIPSJQTGPTGPTIOTJPUJQTJQTIPSIPSGPSGPSGPTGPTGPTHQUIRVJSWNRWOSXROXPMVPMVQNWQNXROYPMWUR\OLVQNXQNXROYROYROYTOXRMVUMXSKVUNUTMTSMRVPUUNWPIR@=A.+/##!'$$ ! !#%(  ",)"1-&5*%'$!.)+&!#+&(.)+/*,4/12*/7/4=67B;FM=FJ8AE5>B7@D5>B5>B5;B6H<9C>:G>:G;:G87D46@79C79C8:D58@99;?<>B;8A85><9C=:D95B:6C95B>:G?:C:5>:6<<8>@=FA>G>9B=8A>7>>7>B>>GCCB;<:34A89D;@D=?D=>MFGC<=C<=JABNEFJCDIBCJFFNJJNIKOJLTNSICHKFOOJSMHQNIRKEJNHMPJOPJOQINSKPQINQINRKTTMVKGTGCPFCMPMWSSTWWXTQSURTPMVQNWPNTRPVWPYVOXTMVOHQUMRZRW^WXXQR\UVXQR\TY_W\VOVVOV[W]\X^QOU[Y_b`f`^db_hc`igghccdekjgmlfjihlknnowwxprvuw{uz{puvtxw{~~tmz~n}vxy{EZ\F[]F[]F[]F[]G\^GZaGZaG[`FZ_I[^J\_I[^HZ]HZ]I[^IZ`IZ`IZaJ[bG[`H\aH\aH\aGZaH[bF\aG]bG]bF\aG^`G^`G^`G^`F[bF[bH[bI\cI\cI\cK\cK\cI[eI[eG\cG\cG\eG\eI\cI\cM]`M]`M]`M]`N[aN[aNXeNXeNXeNXeNYdOZeN\fN\fM[cM[cM\bM\bM\bM\bN]cM\bN]cN]cM\bM\bM[cM[cN\dN\dO]eO]eN]cO^dO^dN]cN\dO]eO]eN\dS\gS\gR[fS\gQYfQYfQYfQYfS\gT]hR\dT^fT^eT^eU]dU]dT[dT[dVZfW[gXYgXYgYZhWXfUWcWYeY[eY[eV[dW\eUZcUZcWYcWYc[XaZW`YV_VS\ZV\YU[XS\VQZYR[\U^[RY\SZ[Q[ZPZYPW[RY\SZVMTVLVSISLHNLHNMJSJGPGDMGDMEBKIFOKHQHENACHACH<@E=AF?AM<>J?@N:;I79C<>H6?C6?C07@07@7=J9?L/5A*0<01?56D65C0/=2/952<:9=326317206)(5-,9'(6%&4%$2%$2) *'1%/&!0% /%",/,66285171&-+ '2(3D:E50?<7F;8A52;94=>9B=9?>:@EDHEDHDCGKJNNIKNIKSNPXSU[UZ^X]]W\\V[e_dhbgg_djbgpjopjommnqqrtttuuusssuuuwuuzxx}}}{{}tmyswy{Qc`Qc`RdaRdaRcbRcbRcdSdeTbdUceUebUebSebRdaRcdRcdQadQadRcdSdeTfcTfcTedTedTedTedTfcTfcRfcRfcRfdRfdRfdSgeSfgRefUfgTefTefUfgTefUfgUfgUfgVghVghUfgTefTdgTdgUfgTefTfcTfcVdfVdfXbiXbiYbeYbeXdfXdfXdfXdfXdfXdfXedXedZddZddZcf[dgZcgZcgXcgXcgVdfVdfTefTefTdgTdgTdgTdgTefTefUehUehTdgTdgUehUehUehTdgTdgTdgVcgVcgVfiUehVfiUehWdhWdhYdhZeiWdhVcgXeiWdhYcjZdk[cj\dk\ei[dhZfhYegWegXfhWdhXeiXeiXeiYdhYdhYdhYdh[dh[dh[dhZcg[dh[dh[dh\ei[dh[dhZcg[dh[dhZcgZcgZcgZcg[dh[dh[dhYdhYdhYdhYdh[dhZcg[dh[dh[dh[dh\dk[cj\dk\dk[dh[dh[dh[dhZcg[dh\dk]el]fj[dhZcgZcg\ei\eiZcg\ei\ei[dh^dk^dk\aj[`i[_k]am^cl]bk\_mY\j^_m`ao\]k\]k`_l`_l_^k]\i^Yh^Yh`[jb]l`[j^Yh^Yh`[j^Vh^Vh^Wf[TcZVcZVcZVc[WdVS]SPZOOYPPZPO\VUbXU_ROYROYSPZOLVNKUSO\RN[IHUMLYGHPBCKCBPFESD?NC>ME@IFAJJFLIEK;;E>>H7=J:@MBESDGU>?M>?M>=K;:HB>K>:GC>MC>M7:H25C58F69G9=BAEJAFI;@C:>C<@EAGL?EJ4?C@KOGQYGQYKQVKQVKPSKPSKQPLRQQVWPUVXU^a^g^^_[[\^^_ddedfjacg[afflqhordkngoohppelohorkrupwznvvlttnuxqx{t{~t{~{x}{~¹û¸¶··ºµ··¶·µtjv~rwxzzTfiUgjTfiUgjUgjUgjUgjVhkWgjWgjUhiVijUhiUhiUgjUgjThmThmTikUjlTikUjlUjlVkmWilWilUjkVklUkiUkiVkmUjlTkmTkmTjoTjoTjoUkpWkpVjoXipXipWkpWkpWlnWlnVjoVjoVjoVjoXjmXjmXjmXjmZhpZhpZgsZgsYgoZhpXjmXjmXioXioXioXioZioZioZioZio\io\io\io\ioZhpZhpXjmXjmXjmXjmXioXioWjqVipTjoTjoTjoTjoTjoTjoTipTipTirTirVhrWisXjtWisVhrWisUjsVktXjtXjtXjtWisYisYisXgsYhtYhtYhtZiuZiu\jt[is[iq[iqYisYisZjtZjt[kuZjtYisYisZjtZjtZjtYisYhtYhtZiuZiuZjtYisZjtZjtYjqYjq[jp[jpZio[jp[iq[iq\jt[isZjtYisWisWisZhr[is[jp[jp[iq[iq]gt]gt]hs]hs[jp[jp[jp[jp[jp\kq]lr]lr\kq\kq[jp[jp\kq\kqZhp[iq]hs\gr_hs_hs_hs_hs^it_ju]hs]hs^fs^fs`hu`huagtbhucivagt`fr`fragsbhtbhtbhtagsbhtdirejsehpgjrhhrffpffpffpagn_el^fm]el\dk[cjY`i[bk\clZaj[bkZajZaj[bkX^jX^jW]iZ`lX_hT[dRXdRXdSYeQWcRYbU\eSZcRYbQWcOUaNT`OUaPVcQWdNT`OUaOUaMS_KQ]KQ]KUbJTaIS`IS`CMZ?IVIT_IT_LV]MW^MU\MU\MU\JRYLR^GMYHN[HN[KQ^MS`NPZMOYOSXQUZTU]ST\QQ[LLVTQ[UR\UR[\Yb^[eYV`YV``]g[Xa[Xaabj`aiUZcX]fX^eZ`gZ]eZ]e__iaakaakaakdembck`bgbdiecieciigmjhnjgpgdmjgphenihljimigmjhneinhlqlpulpumotlnsnpumotomsnlrtrxusytswutxutxtswutxutxusyvtzvtzrpvtrxusyxv|usyyx|}|tvzxz~u{rx}sy~zzxzzz~~rjxo~wxzyZklZklZklZkl\jl]km_km_km^jl^jl`ml`ml]lk\kj\jl]km^ko]jn[lm\mn\mn[lm^ln^ln_mo^ln^ml_nm^ml^ml_lp^ko^nq^nq^nq^nq`mqanranr`mq`mqanr_or_or`ps`ps_or_oranr`mq`mq`mqanr`mqbmqbmqblsblsaoq`np]no^op^op_pq^nq_oranr`mqbmqbmqblsblsblsbls`mq`mq`mqanr`mq`mq`msbou`ps_or]or]or]or]or_or_or`ou`ou`ou`ou`ps`psbru`ps`ps`ps^ou^ou_pv_pv_pv^ou^ou^ou`nv`nv`nvaowbqwbqwapv`ouaqt`psaqt`psapvapvbpx`nvaow`nvaowaow_pw_pw^ov_pw`qx_pw_pw_pw_pw_pw_pw_pw_qt`ru_qt_qt`ouapvaoyaoy]oy^pz\ov]pw^qx]pw`qw^ou`nv`nv`nxaoyaow`nv`ou`ou^ou^ou_pv_pv`qw_pv_pw_pw^ov_pw^rw^rw_pw_pwaoy`nx`nx`nx_pw`qx_ry^qx^my^my^my^my_oy_oy^nx_oyaoy`nx`nx`nx`nx`nx`my`my`nx`nx`nv`nv`nvaowbnvbnvbnvbnv`nv`nv`nv`nv`nv`nv`nxaoy`nx`nx`nxaoyaoyaoy`myanz_nz^my]oy]oyaoyaoyaoybpzaowbpxbpxbpxbpzaoyanzanzbpzbpzaoybpzbpzaoycnycnycnycnyanzanzbpzbpzdpxeqyfpxfpxfpxfpxhoxhoxgp{fozgp{gp{fozfozdnvfpxgnwipyipyhoxgmyflxflxflxhnzgmygkwhlxgjxehvghvijxgjxfiwflxflxdirdirffpiisferedqbdp`bn`bl`bl^`j]_i^_g^_g`ai^_g\^h\^hZ\f[]gW\eY^gW\eX]fSYfSYfSYfNTaMS`MS`NTaKQ^ILZILZILZLO]KLZGHVKKUFFPEGSEGS?ER;AN=@N=@N=@N=@N@CQBN<@L1=E:FN5BN/K@DP@DPC@JDAKHENDAJF?FE>EJGKROSJIMJIMQOUMKQSOUUQWZTY_Y^ZUW]XZb]_b]_iafc[``[]gbdmhjhcegbdidfieelhhihlmlpmlpsrvutxtswutxwvz{yyw}utx~{{|p~iwn|wy{|^ko]jn^ln^ln`lnamo`ln`lnajmbknbnpamoamo`ln`koalpamoamocloclobnpbnpcnrcnrbmqbmqbnpbnpbnpbnpbmqcnrdosdoscmtcmtcmtdnudosdosdosdosdosdosepteptdosdosdosdosdprdprdprdprdosdosfosfosfosenrcnrcnrdosdoseptdosdosdosfnufnufosfosfosfosdosepteptepteptepteoveovdqucptaqtbrubrubrubrubruerververvdquerverververvfswfswdsydsydsyetzdsyetzfswgtxfswfswgtzgtzgtxgtxfswfswfswgtxhuygtxhuyhuyjuyjuyitxjuyiszjt{gtzhu{fu{fu{ft|ft|ft|ft|ft|gu}gv|fu{gwzhx{fwxfwxhuyhuyiu}jv~gwzfvydvyewzgwzhx{hw}fu{jw}iv|hu{hu{hu{hu{hu{hu{hu{hu{gv|gv|gv|gv|ft|ft|fu{gv|gwzhx{gv|gv|ht|ht|hu{hu{iv|kx~hw}gv|ft|ft|ft|ft|fvyfvyfvyfvyfvyfvyfu{fu{etzetzes{es{ft|es{etzetzfu{fu{fu{fu{gs{gs{hu{hu{fu{etzfu{fu{fu{fu{fu{fu{fu{fu{ft|ft|ft~ft~dt~cs}du|du|fu{gv|fu{fu{ft|ft|fu{fu{ft|ft|ft|ft|fu{fu{fu{fu{fu{fu{hu{hu{ft|ft|ft|ft|ft|ft|ft|ft|gtzhu{hu{hu{isziszjt|jt|jt{jt{ivzhuyivzivzhuyivzhu{hu{fu{fu{gwzfvyhu{hu{jt{jt{fu{fu{fu{fu{hu{hu{iv|iv|juyjuyitxjuyjuyjuyjt{jt{iszjt{juyjuyitxitxitxhswhswitxhryiszhryiszhryiszhrzhrzgqyfpxfpxgqygs{frzerxdqwdqudqudosdoseovdnueovdnucmubltcmudnvdmxdmxdnvdnvdnublsantbou`ou_ntcmublt`jr`jrbltbltaksaksdnucmtahqahqcivcivflxdjvbfrbfrbcqbcqbcq^_m^aoadr\_m\_m\_o\_obbsddufera`m`aiefnifoebkifoebkc`igdmhendajebkfclbck`ai^`e`bg`bg`bg`ai[\dZYfZYf^]j]\iXWd`_ledqa`m__i``jc`j_\fb_ic`j^`l^`l[^lZ]kW]jX^kRXeU[hW]jV\i\_m[^lZ`mZ`mSYfSYfX^kW]jVXdTVbUVdWXfSTbPQ_QS_VXdWYeTVbPSaQTbMRbTYiTZgNTaTVbUWcXZf`bnY_kZ`lW^gSZcV]fT[dY[e]_i^`l\^jW]jY_l`frags_gn`ho_foahqgmtgmt_hl_hl_kmdpraqt`psanrfswisziszlt{hpwmvzu~xu~qz~s||{z~{~ûŻǼȻǻǽͽʿξ˽ʽʼɻȼɺǺǼɹȹȷƹȸǶŶŶŵƴű¯r~ht|p~xxz{ìajnajnajnbkobknclocloclobknclodmpdmpdmqclpckrckrdmqdmqdmqdmqenqenqcoqdprcnrcnrdosdosblscmtcmtdnudnudnudosdoscnrdosfosfosfosfosdoseptepteptfosfosfosfosfosgptfosfosfosfosfosfosfosfosfosfosgovfnufnufnufnugovgovfnugovfnufnufnufpwgqxfqufqugqxgqxgqxgqxhpwhpwfpxfpxeqyeqyfsyfsyfsyfsyfswfswfswfswfswfswfswgtxeuxfvyfvyfvyfvyfvygwzfvyfvyfvyhu{hu{hu{hu{jt|jt|jt{jt{juyjuyjt{ku|lv}lv}lv}ku|jt|ku}lulujv~jv~jv~jv~jujulwlwkvkvkwlxkx|kx|ny}ny}lylyjxjxiwjxjxjxjyl{n{mzn{mzkzjykzkzkyjxlzlzkyjxiyiyiyjzizizlzkykyjxkylzlzm{lzlzlzkyhzgygygyiyhxjziyhxiyezdydyezezezdyezgzh{gygygyhzgygygyhziyiyiyiyhzhzeyeyeyeyeyfzfzfzfzeyfzfzfzeyhzgyhzhzhzhzgygyhzgyezf{eyeyfzfzgyhzf{f{ezdyfxfxfxgyiyiykykykvmxkykyj{j{gzgzhzhzgygyeyeyeydxfxgygygyezezezf{gygyhzhzh{dw~fw~j{kylzhzhzhzgyiyjzjzjzjyjyhzhzhzhzhzhzjyjyjzjzjzjzjzjzk{k{jzk{jzk{jzjzm{m{m{m{lzm{m{m{m{m{m{m{m{m{n|o}o}n|o}m{n|o}o}o}o}o}o}o}n|n|q|q|q|p{r{qzpyqzsytztztzrxrxsysytztzrxrxrxrxt{ryrzqyt}qz~pwqxtyv{txtxryqxpxmu|lt{nv}ovls|jp|kq}hnzgmygmzflyekxdjwdjwbhuekxekxciubhtbht`frVcoZgsRamRamTcoRamTblUcmVcoWdpYfrTamS`lP]iP]iQ^jRZgT\iV^kW_lV^kX`mX^jV\hU]jS[hIVbJWcFWeGXfHVeGUdET`ET`CVdH[iJ^iEYd@T_@T_@RbAScBTdCUeBTd@RbDUcGXfAU`;OZ>R]AU`CTb@Q_;OZT_FUaAP\BO[ANZAM\CO^EO^ISbNTaKQ^QTbOR`MS_TZfYdhXcg]af^bgfdjhfleingkpbfk_chcglhlqhlqimreincglhlqjnsjpukqvfqugrvgtxmz~p{oz~pzr|ur|q|q|vuxxxwvx{yvxyyyyz{z|}{zĿƶ¾ÿƿƾ̻ǻǻŻŻŻŻǻǽɼȺƷöŶŭvpzu|}}ƴ²bkobkobkoajnclpclpdmqclpbkndmpdnncmmcloclodmqdmqdmqdmqdmqdmqenqforforenqcoqdprdoscnrblscmtcmtdnudnudnudosdosfosfosfosfosfosfosfosfosgptgptfosfosfosfosgptgptgptgptfosfoshnshnshnshnshnshnsfnugovgovfnugovgovfnugovgovgovgptgpthquhquhquhquirvirvirvirviqxhpwipyhoxjqzjqziqxjryhryhryhswhswhswitxktxjswktxktxluyluyjuyjuyjuyjuyjuyjuyjuyjuylt{lt{lt{lt{lt{lt{nt{ou|nt{nt{nt{ou|nv}ow~nw{nw{pv}pv}pu~qvqvpu~pu~pu~rwrwpwpwpwpwpxpxpy}qz~qz~qz~rzqyqypxqyqyqyqypxqyqyqyqyqyqz~qz~r{qz~rzrzryryryryryryrzrzrzrzrzrzryryszt{s{s{s{s{q{q{r|q{q{q{szrys{s{s{s{r|q{o|o|o|p}m|m|m}n~n}n}q}p|p|o{o{p|p|p|q{q{r|s}n}n}n|n|n|o}o~o~o~n}ppo}n|n|n|o}o}o}n|n|n|o}n|n|o}n|o}o}n|n}o~oon|lzlzm{n|n|o}n|n}n}n}n}m|n}o~n}n}n}n|o}n|n|k|l}l}k|m{n|n|n|n|n|n|o}n|n|o}n|p~p~q}q}n|n|o}o}o}n|n|o}o}o}n|o}p~o}p~p~p~p~p~p~p~p~p~p~r~r~r~sp~p~p~p~p~p~p~qqprstsqqqqrqrrrrrqqrrrrrrrrrrrrqp~o}o}p~qrrqqropmmoprrrrttttttttrrsstusuxussruwsrrtssssrrstrsrppnnnmoppqqprrrrrrrrrrrrqqqqqqqrrqqqqqp~qqqqpqpo}o}q|r}o}o}p~p~p~n|n|n|oznynyp{nynymwlvlvmwlvisismwkuislrio|jqzpwrxntfmvfmvemtemtdktfmvflxflxekwagsbkv^grTbjUckTamVcoWdpWdpUapS_nP]iMZfSaiN\dKYaIW_EWaK]gFXcAS^>O]DUcLZj?M]4CW5DX7FY4CV;GV9ET;GV@L[2DO%7B"6A 4?.9+6-:2?,8-9&7#44%:"2( *, % $#" &*#/7   &!.4)72 .)*$!4.%520@=7B@ALJEKJ>DCISFMWJQYSS[U]fb`ie]idhtonwuqzxtzyv|{vr|r}bkobkoalpalpalpalpbmqalpdmqclpbkobkodjoekpclpdmqdmqdmqenrenrcoqcoqcoqcoqdoscnrcnrcnrcmtcmtdosdosdosdosdosdosfosfosfosgptgptfosfosgptgptfosgptgptgptgptgptgptgptfosgptgptgpthqugptgptgptfosgovgovgptgpthquhqugovgovgovgovhpwgovgovhpwhquhquirvhquhpwiqxjpwkqxiqxiqxiqxiqxiqxiqxhryhryhryhryhryhrygqxgqxkszkszkszlt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{mu|mu|mu|lt{lt{mu|mu|mu|ow~nv}nv}nv}ow~nv}ow~nv}nu~nu~qvqvqvrwrxsysysysyrxrxsytzsyrzqyqxqxqyrzqyqysytzrzrzrzrzrzrzrzrzrzrzryryryryryryryryryrytyuzryryszt{szt{szszs{t|t|t|t{t{t{t{t{t{t{t{u|u|t{t{r|r|p}p}p}q~q~q~r|r|r|r|u{u{v|v|u|u|s}t~sr~sr~r~ssssssssr~r~r~sssr~r~r~r}r}s~r}r~sssuvstp~o}m{o}qqqqqrqqqqrqrrqqqqp~qqqs~s~s~s~qqrqrrqqttttqqqrrrrrrrrrrrrrrsssrrrrrrtutsstsstttsssttsstvutuvutttttttttttuututtssssttttttppporrrrttvvvuvvvvvvxwxwsttuuutwwutuutvuvuuvwvvussrrrqqrrturttttrrrrtttssstsssstssssssssqqqqqpssssrqpprrsstttttsstrrrrrrprsrtttsp}q~p}o|p}trq~o{nzo{o{l{kzjxiwft~ft~gtfsft~ft~iy|fvybstbst^su`uw`ty_sxauzauzct{^ov]lxYht[htZgs`kv]hs]gt_ivUdpO^jN`kL^iJ^iJ^iJ]kJ]kHZeJ\gN]iKZfGYdHZeAU`;OZ@N]DRaDQ]ANZAOY?MWAJUCLWGNWDKTBKOAJN@IM?HLAJNAJN17<6AE3>B,;A2AG4?J7BM;DHFS;GVQA;N>8KA;NJDWGDWB?R@?R@?R=?QACUBDVFHZMN\KLZJGZMJ]OQcSUgRXeX^k\`lZ^ja`ndcqhdqkgtrlwys~xs|xs|}x~y}ȿƿƻ»¸~y~twrurvjnfjgk\_|]`}bb``[]|VXwVXwRTsVUwVUwUUtMMlKJlJIkA=h=9dB?fLIp53W53W;1a1'W<,]9)Z5(Z0#U" L!K+,T#$L+,V56`,(S=9dIGk;9]97[64X(*V02^17f%+Z"L16`38]5:_"L#&P9>c6;`+0U#(M26]9=d2:[8@a=Hh5@`8Ee;HhWBGd=B_//M22P0.L20N25R03P(0L#+G*G".K'1M&0L+3O#+G$+I%,J)1M,4P08T6>Z-5V(0Q&2O)5R5?ZAB]AC\CE^HJcGIbOOhNNgSPcVSfZRdXPb`Yhg`od\ne]oldvphzmfuqjy{q{~t~x||»¿ν˾ʼȷǵű«tshgnkolggrrjjddmi_[y_X}b[TSuKJlQMqRNrGDlLIqFGjDEhC?j?;fC=fHBk=7`2,U-&M:3Z;6];6].1[.1[$*Q#)P',O!&I"%O'*T&L F'4Z'M ?$N!K ? E M"QG C CEHDJ )T(S'R%.Y*N*N%1M".J'/P(0Q06]5;b,7W#.N(1O1:X39`5;b5@f5@f4>g3=fJgFRoY_QWxIUrVbO^yTc~^mYh]maq[j}]lbrcslwlwr}s~m{m{k|k|rx|y{{~z|alpalp`koalp`mq`mqanr`mq`mqanrcnrcnrcnrcnrbmqbmqbnpcoqdprdprdosdosdnucmtcmucmudnvdnvbnvbnvbnvbnvbnvbnvbouboubouboubouboubnvbnvbnvbnvdnvdnvbnvcowbnvbnvbnvbnveovdnueoveovdnudnufnufnufmvfmvfmvgnwfmvgnwgovgovgovfnugovhpwhquirvirvirvirvirviqxiqxgqxgqxhrzhrzfpwgqxgqxhryjryjryjqzipyhq|hq|hq|hq|hrzhrzhryiszis{hrzkr{ls|lt{lt{jt{jt{jt{jt{jt|jt|jt|jt|kr{ls|ls|ls|ls|ls|lr~lr~ls|mt}mu|mu|mu|nv}mt}mt}mt}mt}lr~msntououpvntoupvpvpvpvpwpwpwpwpwqxqwqwqxryqyqytztztytyvxvxtytyryryqys{rzrzrzqyqxqxqwpvrvrvountlv~lv~lv~mwmvluluktktktjrjriq~jreo|eo|hrfp}dlydlydlydlyblybly_lx]jv\iu_lx_lx]jv^kwZgsZfu[gv]gv^hw`jyakz^hw]gv\ev^gxahybiz`gxbizdhzfj|fj|cgyfi~eh}egybdvfesfesghvjkyhiweftggxjj{hgujiwojynixmhwkfuihvlkyom~pnlj{jhygftgftjj{ggxkfujetidshcridsidsa`ndcq`_t\[p`\s`\s]Tp\So\So`Ws^\s[YpXZsTVoRRqOOnPJmICfPDhJ>bC?]D@^?BX>AW?CUAEWIHUDCPHHHJJJGJKILMHJOIKPGJKGJKKKKKKKJJJJJJJJJKKKKKKJJJJJJKKKGLOKPSLQaJO_GJ_EH]JP]LR_MNi]^ycZu\Snm`yzmy~ļƿƿƿƿɾǽƻĻŸ»ĵIJDz¬ızxv~|||pznxr}nykvitkykybq[j[kfvlwgrimfjimdhbe{ornrgk}b`~^\zbdcegnpwptlpdg}_bx_gem[eYcWbz\gVeyQ`tEQmEQmMYuJVr?Ni?NiL[vBQl@Jf9C_05Z.3X-3T39Z2@]/=Z-6[+4Y,4V.6X.8Z:Df3D_'8S'0N,5S.1N-0M-2H16L/7S08T1>^/<\4B_DRoL_sDWk:Re7ObC\sOhQgzPfyRdtYk{[n|WjxZl|btfuethwkzm|m|tssxzyxwx}alpalpckrckrblsakrbmqbmqcnrdoscnrcnrcnrbmqbmqbmqcoqdprdprdprdosdosdnudnuemtfnudnudnudnudnudnudnudosdosdosdosbosbosantantbnvbnvbnvbnvdnvdnvdnvdnveoweowdnvdnvdnueovgovgovfnugovgovfnufmvfmvfmvfmvgnwgnwgovfnufmvgnwhpwhpwhquirvhquhquhoxhoxipyhoxipyipyhrzhrzgqygqygqxhryjryiqxhrzgqyhrzhrzfrzgs{frzfrzis{hrzhrzhrzls|ls|lt{lt{itxitxjuyjuyjuyjuyis{is{ls|ls|lr~lr~lr~lr~lr~lr~mt}mt}mt}mt}mt}mt}msntmsmsmsntnu~ovnv}nv}nv}ow~pwpwpwpwpwpwqxpwpvqwqwqwqxqxryqxqyrzrzrzryryrxrxrxrxsysyt{t{t{t{tztztztzu{u{t{u|t{t{u|u|v}v}u{v|u{u{u{v|u{v|v}v}u|u|u|u|v|v|u{v|s|t}t}t}u~t}s|t}w}w}w}w}w}w}v|v|w}w}w~w~xxxxxxz~z~z~z~zzzzz~z~z~z~{|zyzxw~v}w}w}u{u{v|syrxrxpvntlrlriq~iq~fp}blybl{]gv`izdm~fobk|\gx]hy]k{XfvUgwRdtN_sN_sM]tK[rKYpAOfAIe;C_;@]AFcCGa<@Z<@Z9=W'/I#+E'G%E"G!F"@ >$>!;34&&! ! ! ! ! "!!"!"!" !!"!"!" #$ "&!% #$"%&%%&%%&%%&&&'%%&%%&&&'&&'''(''(''(''(''(''('''''')&(-*,D/@E0AJ$EW1Rj@`g=]\7Ob=U]:Rb?WrXjiOanTfgyqttw{ֿҾѺͲŸɷȴƲĭ}}x~qyt|v}pwktktcmcm`o\k~`mYfy^gdmYbXaW_[cYdQ\|9Hp,;c1Er7Kx2Nq*Fi,?h*=fELw>Ep?EfLRsNTu>De*4]0:c1Bk9JsGW|9In+5W)3U18]29^/6h.5g/8e)2_,3^6=h-3a06d)3b(2a7Iu7Iu/Iq;U}6V{)In0Lo@\J]H[~ReTgQb}VgVeWf^i]hgqkuo{o{kxq~r~q}rssp}r~srvx|wvxyalpalpclpclpclpdmqbmqcnrcnrcnrcnrcnrbmqbmqbmqbmqanrbosbosbosdosdosdosdosdosdosdosdosdnudnubosbosbosbosdosdosdosdosdnudnudnudnuboubouboubouboubouboucpvdnudnudnudnueovdnugovgovfnufnugovgovfnugovgnwgnwgovgovgovgovhquirvirvhqugovhpwhoxhoxipyipyhoxipyiszhrygqxhryhrygqxgqxgqxgqyhrzjqzjqzjqzkr{kr{kr{jqzkr{jqzkr{jt|jt|jt{jt{juyitxitxitxjt{iszjt|is{kr{ls|ls|ls|ls|ls|mt}mt}mt}ls|mt}mt}msmsmsmsmslr~nu~nu~nu~nu~nv}nv}ow~pxpwpwpwpwpwpwpwpwpvqwqwqwqxryqxryryryryryryryrxrxrxrxrxsys{t|t|t|t{t{tztztztztzu{w}w}v{w|w{w{w{w{u{u{v|w}v|v|v|u{u{u{w{w{u{u{u{u{u{v|v|v|w}v|v|u{v|w}w}w}w}v|v|v|w}w}w~w~xxxxx~x~x~x~xxxxxxx~x~yyyyzz{z{{{|||}||{|}||}}~}}}|||||||||||||}}}}}~~}~}~|{uwqwquorqqp~qp~rqpj|hbtcYqe[sh^vbXpcVobUnZOjWLgMCbKA`C;^>6Y<1R=2SA/QC1SB3S>/O1*I1*I,.G*,E'.?"):)1(0(,&* &+"(- &+%*$)#(#*")%%%#      ')/1./+,79E-GG2JI4LP>SO=RRDTZL\`S_cVbbW^i^enciqfl{pv}rx{rs~uvz{z{{|}~}|¹ͼȹźƹŲ²±~|~ztvtxlwlwqzluclpbkoclpclpclpdmqdmqdmqdmqdmqdmqdmqdmqdmqbmqcnrcnrcnrcnrcnrcnrcnrenrfosenrfosenrfosfosfosdnudnudnudnudosdosdosdosfosfosfosfosdosdosdosdosdnueoveoveovepteptdoseptdoseptgptgptfosfosgovgovgptgptgptgptgptgptgovgovhquhquhquhqugnwgnwhoxipyjswirvirvirvhryhryhrzhrzhryhryhrygqxhryhryjryjryjqzjqzkr{kr{jp|jp|jp|kq}ls|ls|ls|ls|kr{jqzkszkszkszkszkr{ls|ls|ls|lr~mslr~msot}ot}ot}ot}mt}mt}msmsmsntmt}nu~nv}nv}nv}nv}nv}ow~ow~pxpwpwpwqxpwpwpwpwpwqxqxqxqxqxqxqxryqxtytyryryryrysyrxrxrxrxsytzsysysysytzvzw{u{u{u{u{t{t{v}v}u{u{u{v|v|v|v|v|v|v|x|w{w{w{u{u{u{u{v|v|v|v|x{x{x{x{v|v|v|v|v|v|v|w}w}w}w}w}w}w}w}x~x~x~x~x~xxxxx~x~x~x~x~x~x~x~zzz{{{{|||}}||}}}}}}}}}~~~~~~~~~~~~~~~~~{yuuuvxt|t|v~yx~s{s{s}r|mylxkwkwhtfrkrovjqjqjqgn~enbk|\gx[fwZevXctQ[pNXmLUmJSkNVcNVcMS_MS_MU\OW^OT]OT]OUZOUZOVYOVYOVYOVYOVYOVYNTYNTYNUXOVYOVYNUXNUXNUXNTYNTYNTYNTYNTYOUZOUZNTYNTYNTYNTYOUZNTYNTYNTYNTYNTYNTYNTYNTYPTYPTYPTYPTYQUZQUZPS[ORZNQYPS[QUZNRWMQVLPUNRWNRWKOTKOTKOTJNSKOTKOTIMRFJOCGLDHMCEJEGLDBHDBHB?H@=F@=F?KW5AP2>M1$< / , * ) % $          #"("!%#"&(%'-*,.,,0..1//200422533755:88:88:88888<<<>>>@@@LLM\\]`^dljpwy~suzŶƷ`koalpalpalpbmqbmqblsblscmtblscnrbmqanranranranranrboscnrcnrbmqcnrcnrcnrdnucmtdosdosfosfosfnufnufnufnufnufnufosfosfosfosfnufnufmvfmvfnufnufnufnufmvfmvfosgptgptfosgptgptgptgptgptgptgptgptgptgpteptfquboscptboucpveovfpwfpwfpwipyipyiqxiqxhquhquiqxiqxiqxjrykr{jqzkr{jqzjqzipyjqzkr{jqzjqzkr{jqzjqzkr{kq}lr~kq}kq}ls|ls|kr{kr{jp|lr~lr~lr~ls|ls|ls|ls|ls|ls|lr~lr~lr~msmt}mt}ns|ns|ns|ns|nu~nu~ow~nv}mu|nv}nv}nv}nu~mt}msntntoupwpwovovoupvpvpvqxpwpwpwqxqxqwqwrxrxrxrxryryryryrxrxsysyszszszszuzuzvzuyu|u|u|t{u|u|s}s}s}s}s}r|v}v}v}v}u{u{w{x|x|x|x|x|w{w{u{v|v|v|v}w~w~w~v|v|u~u~uuuuw~w~w}w}w}w}w}w}x~x~x~w}x~w}x~x~x~x~x~yx~yyyzzzzzzz{|{{|z{{{z{{{}|{{||||||}~~~~~~~~}~~~~}~~{|}}{{{zz{|}~}||}}||||}||||||~~||||}zzxxyyz{zxwwwuyzz{xxxwxxxxvvvuvu~s|u~vqzqzpynvnvltltlr~flxciu`fr`fsdjw`euZ_oY]oTXjMMfAAZ@9X<5T>>\AA_14W(+N%'M#%K#*@&<"(4 &2!',!',$,3#+2!(1%.%(&)''''&) ),%,")#'$(%2%2!: ";!;#=`koalp`kobmqbmqbmq`mqanr`mq`mqanranranranr`mqanrcnrdoscnrcnrcnrcnrdosdosdosdosdosdosdnudnudnudnufnufnufosfosdosdosdosdosdnudnudnvdnvdnvdnvdmxdmxdnvdnvfnugovgptgptgptgptgptgpteoveoveoveoveptfquepteptcpvcpvcpvdqwdqwdqwfpwfpwiqxiqxhoxipyhoxipyhoxhoxipyjqziqxjrykszkszjqzjqzjqzjqzjqzjqzjqzjqzjqzkr{kq}kq}kq}lr~lr~kq}ir}ir}js~js~jt|jt|ls|ls|ls|ls|ls|ls|lr~lr~ls|mt}mt}mt}mt}mt}mt}nu~pu~qvpu~pu~ot}pu~ot}pu~pv}pv}pv}pv}pu~rwqvrwpwovpvpvpvqwqwpvqwqwqwqwqwrxrxrxrxrxrxrxryryryszszszsysysysyuyuyvzw{u{tzu{tzu{u{s}s}t~t~r|s}u|v}v}u|u{u{wzwzx{wzwzwzwzwzw{x|x|x|x|x|v|v|v|v|w}w}u~u~u~u~u~u~w}w}w}w}w}w}x~x~x~w}w}x~x~x~xxxyzyzyzzzzzz{||||||}}||}|}{{{|||||||||||||~~~~~~~~~{||wtsp}n{mzmzn~jzbvau[sUmzLiuNkwJiuHgsA_m@^l;Uh3M`8Kf1D_1=Y1=Y4>Z:D`5AV7CX`kobmqbmqbmqcnrcnrenrdmqbmqcnrcnrcnrdoscnrcnrcnrcnrdosfosfosdosdosdosdosdosdosdosdosdosdosdosdosgptgpteptdosdosdosdosdosdnudnudnudnudnveowgmyflxgnwgnwgovgovgovgovfnufnufnufnugnwgnwgovgovgptgpthpwgoveoveovfpwfpwfpwfpwhpwhpwhpwhpwhpwhpwipyhoxiqxiqxjryjryktxktxktxktxktxktxlt{lt{kszkszkszkszkszkszls|ls|ls|ls|ls|ls|ls|ls|ls|ls|ls|ls|lt{lt{lt{mu|ku}ku}jt|ku}lv}ku|mu|mu|mt}nu~pu~pu~pu~pu~ovovow~nv}mu|nv}pu~qvovovovovpxpxpwpwoupvqwpvpvpvqxqxqxryrxrxrxrxrxrxrxrxrxrxuzv{v{uzuyuytztzsytztzu{u|u|u|u|u|u|u{u{u{u{u{u{v|u{w{w{w{w{x|x|x|x|v}v}v}v}v|v|v|v|v|v|v|v|v|v|v|v|v|v|v|v|v|w}w}w}w}w}w}w}w}w}w}w}x~x~x~x~xyyyyzzzzz{zz{{|||||}||||||||}~~~~}~||||||||~~~~_lp_lp_lp`mqbmqbmqblsblsdlsdlscnrcnrcnrcnrcnrcnrcnrcnrdoscnrdosdosfosfosfosfosfosfosdosdosdosdosdosepteptdosdosdosdosdosdoseptdosdoseoveovgnwgnwgovgovgovhpwgovgovgovfnugovgovgnwgnwgovhpwhquhquhpwhpwgnwhoxipyipyhpwiqxiqxhpwhoxhoxhoxipyipyhoxipyjqzktxktxktxktxitxitxitxjuyjuyjuyluyluyluyktxnt{nt{ls|ls|ls|ls|lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{ls|ls|msmsmt}mt}nv}nv}nv}nv}nu~ovpu~pu~pu~rwpwovovnu~pu~pu~pu~qvow~pxpxqyqyqyqyqyqxqxqxpwqxqxqxrytytytxtxrxrxrxrxryryryrytyuzv{v{t{t{t{u|sysysytzt{u|u}u}u|u|u{u{w{x|x|x|w{w{v|v|u{v|v|v|u{v|v}v}v}v}v|v|w~w~w~w~w~w~v|v|w}w}w}w}v|v|v|w}x~x~w}x~w}w}x~x~x~x~x~x~yx~xyxy||||z{{z{||{{||}z{zyzz|}}~~~~~~~~~~~~~~~~~~~^kq_lrakrblsakrblscjscjsdlsemtcmtcmtcmtblscnrcnrcnrcnrcnrdosdosdosdosdosdosdosdnudnubouboubosbosboscptcptbosdnudnudnudnudnudnudnudnueoveoveovfpweoveoveoveovhpwgovgovgovfnufnufnugovgovgovhquirvirvhqugovhpwhpwhpwhpwiqxhpwhpwhoxipyiqxiqxhpwhpwjryjryjryiqxjqzjqzkr{kr{kszkszkszlt{lt{lt{lt{lt{ns|ns|ls|ls|ls|ls|lt{lt{lt{lt{lt{lt{lt{lt{ls|ls|mt}mt}msmsmt}nu~nv}nv}nv}nv}ow~nv}nu~nu~pwpwpxow~ovovovovpwpwqxqxnxoyoyoyoypzqyqyqxqxqxryrzrzr{r{rzrzryszsyrxrxrxsyrxszt{t|t|t|u}u}t|t{t{tzu{u{tzv}v}v}u|u{u{x|x|x|x|v|v|v|w}u{v|v|v|x|x|v|v|v|v|v|v|w}w}w}x~w}w}w}x~w}w}w}w}w}w}w}x~x~x~x~x~w}w}x~x~x~x~x~x~yxyxyzzzzzzz{{{|||{|}}{{{z{{{|~~~~~~}~~~~~~~~~~_lp`mq`mq`mq`ms`msblsakrblscmtemtemtemtemtenrenrenrenrcnrdosdosdosdosdosdnudnufnugovdnudnudoseptdoseptdosdosdoseptfosfosfnufnufnufnufmvgnweoweoweoweoweoweowgovgovgovgovgovgovgovfnuiovioviovkqxkqvjpuiovjpwjpwjpwjoxjoxgnwhoxipyipyipyipyipyhoxipyipyipyipyipyjqzjqzjqzjqzkr{kszkszlt{kszmszmsznt{mszmr{mr{mq}nr~ns|ns|ns|ns|ls|ls|ls|ls|ls|mt}mt}mt}mt}mt}nu~nu~nv}nv}nw{ox|ow~nv}ovovpwpwovovovovpvououpvpvpvpvqwpwpwqxpwqxqxqwrxtytytztztztzryryszszszszszszszszt|t|t|u}u}t|t{t{t{u|u{u{u|v}v~v~v~v~v|v|u{v|v|u{v|v|w}v|v|v|v|v|w~w~v}v}w~w~v|w}w}w}y}y}y}z~x~x~xxx~x~x~x~x~x~vvvvvvx~x~x~x~x~x~x~x~xyzzzzzz{z{{||||}}}~||{{{|||~}~}}~~~~~~~~~~~~cnrcnrcmtblscmtcmtbmqcnrdoscnrcnrcnrcnrcnrenrenrenrenrfosfosdosdosdosdosdnudnuepteptbouboubosbosdosdosdoseptgptfosfosfosfosfosfnufnufnufnueoveoveowfpxeoweowfnugovhqugptgptfosgovgovhpwhpwhpwiqxirvirviqxiqxhpwiqxiqxiqxiqxiqxipyhoxipyjqziqxiqxiqxiqxjrykszjryjryjryjryjswjswluyktxluyluykszlt{kszlt{kr{kr{kq}kq}nr~nr~lr~lr~ls|ls|ls|ls|lt{mu|mu|mu|lt{mu|mu|mu|mu|mu|nv}nv}nv}mu|ntouow~ow~ow~pxpwpwpwovouououpvqwpvqwqwqwpvqwqwrxqwrxrxryryryryryryryryryszsysyszszs{s{t|t|s{s{sysytztzu{u{u{u{u|v}u|v}u{u{u{u{w{w{v|v|u{v|v}w~w~v}v}v}v}v}w~v}v}w~x~x~w}w}w}x~x~x~x~x~x~w}w}w}xxxxx~x~x~x~x~x~x~x~x~x~x~x~yyyzzz{{{{{||}}}}}~~||{{{|~~~}~~~~~~~~~cmtcmtdnvcmubouantanrbosbosanrcnrcnrcnrdosdosdosbosbosboscptboscpteptdoseoveovcptcptcptcptcptcpteoveoveoveovfosfoseptdoscptcpteovdnudnudnueoveoveoveoveoweowfpxfpxfpweoveoveovgovhpwgoviqxirvirvhquhquhpwiqxipyipyjryiqxjryjryiqxiqxjryjryiqxiqxiqxjryjryjryjryiqxjswjswjswjswkszkszlt{lt{kszlt{kszkszkr{kr{kr{kr{kr{ls|ls|ls|ls|ls|lt{lt{mu|lt{lt{lt{lt{mu|nt{nt{ns|ot}ot}ot}ptptpu~qvovnu~ovpwpwovouououououpvqwpvqwqwqwqwqwqwqwqwqwrxrxqwrxrxryryryryrxrxrxrxrxrxszt{szszszszsysysytzu{u{v|u{x|x|w{w{w{w{v|u{v|v|v|v|v|u{u{v|w}v|w{x|x}x}x}w|x|x|y}y}w~w~x~w}w}w}x~w}w}w}w}w}w~w~w~w~w}x~x~x~x~w}z~z~x~x~x~x~yyyy{{|}{{{||||}}}}~||||||~}~~~~~~~~emtemtemtfnufosfosfosfosfosfosfosenrfosfosfosfosdosdosdosdosdoseptgovgovgovhpwgptgptgptgpthquhqugpthqugptgptfnufnugptgptgptgptfnufnufnugovgovgovgovhpwgqyfpxfpwgqxgptgptgptgptgovgovhpwiqxirvirvhqugpthpwhpwipyipyiqxiqxjswjswjswjswjswirvhswhswgqxhryhryhryjswjswjswjswktxjswlrymszkr{kr{ls|ls|ls|ls|ls|ls|kr{ls|kr{ls|lt{lt{lt{lt{lt{lt{mu|mu|nv}mu|lt{mu|mu|mu|ot}ot}nu~nu~nu~ovovnu~ovovow~pxpxpxououpvououpvpvpvqwqwqwpvqwrxrxqwqwrxrxrxrxrxryryryryryryrxrxryszszryszszsytztzsyt{t{u|u|v}u|v}u|u|u|v{w|w{x|x}x}w|w|u{u{v|v|v|u{w{w{x|x|x|w{x{x{w}w}w}w}x~w}w}w}w}w}w}w}w}w}w}w}w}w}w}x~x~x~x~w}x~x~x~x~x~x~xyyyyyyyzz{{{{|}}}}~~~~~~}~}~~~~~~~~~~~~~enrenrfosfosfosfosfosfosfosfosfosfoseptdoseptdoscptcptdqucptfqueptdnueovgovhpwgptgptgpthquirvirvhquhqugovgovgovfnufosgptfosfosgptgptgovgovhpwgovgovhpwirvjswgrvfqugptgpthpwgovhpwgovhpwhpwipyipyiqxhpwhpwhpwipyjqzjryjryirvjswjswjswhryhryhrygqxgqyhrzhryiszkszjryjryiqxlrymszns|mr{kr{kr{kr{ls|ls|ls|ls|ls|ls|kr{ls|ls|luyluyluyluylt{lt{lt{nv}ls|ls|mt}mt}mu|mu|mt}mt}ntouountovpwox|py}py}py}ow~ow~pxpxpwpwovpwqxqxqxqxqxqxqyrzqyqyryryrxrxrxrxrxrxrxrxsyrxrxrxrxrxszt{t{t{tztztztzu{u{tzu{u|u|u|u|u|u|u|u|u|u|u{u{w{vzw{w{x|x|w{w{w{x|x}x}x}w|v}w~w}w}w}w}w}w}v}w~w~w~x~x~w}w}v}w~w~w~x~x~x~w}w}w}x~x~w}x~x~x~x~yyzzzzzyz{|{|{|}}}}}|}}}~~}~~~~~~~~~~~}}~}~~enrfosfosfosfosgptfosfosgptgptgptfoseptepteptepteptfqufqueptepteptgpthqugpthqugpthquirvirvhquirvirvirvirvhquhqugptgptgptgptgptgptgptgptfosjpwjpwjpwjpwhqujswgrvfqufqufqugpthquhqugptgovhpwipyipyipyipyhoxipyiqxjryjswirvirvirvirvjswjryjryjryiqxio{io{jrykszktxktxjswjswjqzjqzmq}mq}kr{kr{kr{kr{kr{kr{kr{ls|ls|ls|ls|mt}luyluyluymvzlt{mu|mt}mt}lr~lr~lr~msot}ot}mt}ovnv}nv}ovovpxpxpxow~pxpxqyqyqyqyqyqyqz~qz~r{r{rzqyqyrzqyqyqyrzryryryryrxrxryryryszryryryszszszszszszszt{t{u{u{v}u|v}v}u|u|v}v}u|v}v}w~v}v}v}v}u{u{v|w}v}v}v}v}v}w~v}v}v}w~w~w~w}w}x~w}w}w}w~w~w~w~xxx~w}w}w}x~x~x~x~x~x~x~x~x~x~x~x~x~x~x~x~yzzzzyzz{{{{}|}~~}}}}}}~~~~~~~||}}~}}{{||~~fnufnuforforfosfosfosfosfosfosfosfosepteptdosdosepteptgptgptgovhpwhpwgovgovgovhquirvhquhquhquirvgrvgrvgrvfqufqufqufqueptgptgptgptgptfosgpthpwhpwgovhpwiqxiqxirvirvirvhquhpwgovgovgovhpwiqxjryhpwhoxhoxhoxipyipyipyirvirvirvhqujryiqxjqzjqzipyipyio{jp|kr{kr{jqzkr{lqzlqzlqzmr{mq}mq}mr{ns|nt{msznt{nt{ls|ls|ls|ls|lt{lt{lt{lt{lt{lt{lt{lt{mt}mt}mslr~msmsmt}mt}nu~ovnu~nu~nu~pwpxow~ow~ow~ovpwpxqyr{qz~qz~qz~qz~qz~qz~r{qyrztzsysysyrzrzryryrxrxtxtxtxtxszszryrysyrxszszszszt{t{t{u|u|v}v}v}w}v|x}y~x}x}x}y~x}x}x}x}x|x|x|w{v|v|v}v}v}v}v}v}v|v|v}w~w~xw}w}w}w}w}w}w}v|x~x~w}w}w}w}y}y}x~x~x~x~x~x~x~x~x~w}x~x~x~x~yx~yyzyzz{|{|||||}}}}~~~}~}~~~~~~~~}}{y{~~fosfosfosfosgptfosfosfosfosgptgptgptepteptepteptdosdosgovgovgpthquirvhquhquhquiqxhpwhpwhpwhpwhpwfpwfpwfpwfpwfpwfpwfqufqueptfqudosdosfnugovhpwgovhpwhpwiqxjryjryiqxjswirvhqugptgptirvirvjswiqxjryhoxhoxhnzio{ipyipyirvirvjswirvjswktxjryjryjqzjqzjqzjqzkszkszkszkszlrymszlqzlqzmq}mq}kq}lr~ls|ls|ls|ls|lr~lr~lr~lr~lr~lr~lr~lr~lr~lr~lr~lr~lr~msmsmsmsntmt}mt}nu~nu~nu~ovpwpwpxpxovovouourwtyrzqyqyqyqyrzqyqyqyqyqyqyqyrzryryrxrxrxrxrxrxryszszryryrytxtxuzuzv|u{u{v|v|v|w|x}x}x}x}x}z|z|y}x|x|x|x|x|x|x|x|x|w{x|v|v|v|v|v|v|v|v|v|v|w}w}w}v|y}y}w}v|w}w}w}w}w}x~x~w}w}w}w}w}x~x~x~x~x~x~x~x~x~x~x~x~yyxyyy{|zz{{||||}|}}~}~~~~~~~}|zzwx|}eptdosdosdoseptdosdosdosepteptfosgptgptgptfosfosfnugovgovgovfqugrvfqugrvgrvfqugrvfqufpwfpwiqxhpwhpwiqxirvirvhquhquirvhqugovgoveovfpwepteptfqufqugrvgrvgqxgqxgqxgqxjryiqxiqxhpwhquirvlrwkqvipyipyipyipyipyipyiqxjryirvjswjswjswjswjswkszjryisziszisziszisziszjrykszkszkszkszkszkr{kr{ls|ls|jt{jt{jt|jt|jt|jt|ls|ls|ls|ls|ls|ls|ls|ls|mt}mt}mt}mt}mt}mt}mt}nu~mu|nv}ow~ow~ovovpwpwow~pxovovntouqwqwrzrzqyqyqyqyqyqyrzqysytztztztytytytytxtxrxrxszryszrytytyryszszryuzuzv|u{v{v{v{x}x}x}z|z|z|{}x}x}w~v}v}w~v}v}y~x}x|x|x|x|x|x|v|u{v|v|v|v|w}v|v|v|y|y|y|y|w}x~w}w}x~w}x~w}x~x~w}w}x~x~x~x~x~x~x~x~x~x~x~x~yx~x~x~yzzzz{{|{|}}}~~~~~~~~~~}}~~~~fosfosfnufnufosfosgptfosfosgptfosgptgptgptgptgptepteptfqueptfpwfpwfpwfpwfqufqugrvepthpwhpwhpwhpwhpwiqxirvirvhquirvgovgovgovgovgovhpwhquhquhquhquirvirviqxhpwhoxhoxhoxipyiqxhpwhpwiqxiqxhpwiqxiqxiqxiqxhpwiqxiqxiqxjswktxktxktxjswjswkszkszkszkszlt{kszkszkszkszkszluyluyktxluylt{lt{lt{lt{lt{lt{lt{lt{ls|ls|ls|ls|lt{lt{lt{lt{mu|mu|nv}nv}mt}nu~nv}nv}mu|mu|nv}nv}ow~ow~qvqvqvqvqvqvpwovpvpvpwqxqyqyqyqyrzqyqyqyqyqyqyrztztztytytytytxtxryryryryryrytytys{s{s{s{t{szv{v{w}w}w}w}x~x~x~x~yx~w~v}w~w~w~v}v}v}v|v|v|v|w}w}w}v|w}v|w}w}w}w}w}w}w}w}y}y}z~z~x~w}w}w}x~x~x~x~xxxxxxx~x~x~x~x~x~x~x~x~x~z~z~z~z~zzzzzz{{||}}~~~~~~~~fosfosfosfosfosfosfosfosfosgptgptgptepteptepteptfqufqueptfqudquervdqudqufpwfpwfpwfpwhpwiqxiqxiqxiqxiqxiqxjryhoxipyhoxhoxhpwhpwhquhquhquirvirvirvirvirvipyhoxhoxipygqygqyhrygqxfpwgqxhpwiqxipyipyipyipyipyipyhoxipyjqzkr{jryjryjryiqxjqzkr{jqzkr{jqzkr{jqzjqzkr{ls|kszkszlt{kszlt{lt{lt{kszlt{lt{lt{lt{lt{lt{lt{lt{ns|ns|ns|ns|lt{lt{ls|mt}msmsnu~mt}mu|mu|mu|nv}ou|pv}susususupwpwovovpwpwqxqxsysysy~sy~qz~qz~rzrzrzqytztztztztytytytytxtxuytxtxtxtxtxsyrxsysyszt{t{t{t|u}v~u}w}x~x~x~yyyyx~x~x}w|x|w{x|x|x{x{u{v|v|w}w~w~v|w}v|w}y}y}w}w}w}w}y}z~z~z~x~x~w}w}x~x~x~x~xxxxxxx~x~x~x~x~yx~x~x~x~{z~z~{{||}}}||||}}}~~~~~~~fosfosfosfosfosgptfosfosfosfosfoshquhqugptgpthquhquhqufqufqugrvgrvgrvfqugqygqyfpwfpwiqxiqxiqxiqxiqxiqxiqxjryjqzjqzhoxipyiqxiqxjpujpujpujpuhquirvirvirvhpwhpwipyipyiqxiqxiqxiqxiqxiqxhpwiqxiqxjryjryiqxhpwhpwiqxjryjryjryjryiqxjpwkqxlqzlqzio{jp|ipyipyipyipykr{kr{lt{kszkszlt{lt{lt{lt{ksznt{nt{ntyntyntyntynt{nt{ns|ns|ns|ns|ns|ns|msmsmt}mt}nv}nv}mvzmvzouzouzpv}qw~sv~sv~tvrt~qvqvrwrwrwsxsxrwsxsxsysysxsxtysxsytztztztytyrxrxrxrxrxrxtxtxtxtxsysysyrxsysyuyuyv|v|v|w}w}w}w|w|x}x}x~x~yyw~v}v}v}v}v}v|v|x|x|u{v|v|v|w}w}w}v|v|w}w}w}x~w}w}x~z~z~z~z~x~x~x~w}w}w}x~x~xxxxxxx~x~xyyxz~z~z~z~z~{z~{}~|||}|}~~~~~~doseptdosdosdoseptgptfosfosgpthquhquhpwfnugovhpwhquhqufqugrvgsugsugsufrtfqugrvhpwhpwhquirvirvhquiqxjrylrylryjqzipyio{io{iqxhpwirvirvirvhquirvirvhpwiqxiqxiqxiqxiqxipyipyipyipyjryjryjryjryjryjryiqxhpwgqyhrzhryhryhryhryhryhryipyjqzjqzipyio{io{ipyipyipyipyjqzls|kszlt{luyktxluyluylt{lt{ns|ns|pr|pr|nt{nt{lt{lt{mu|lt{nt{nt{ns|ns|lr~msmu|nv}nv}ow~nv}mu|mu|nv}ou|pv}qw~qw~pu~qvqvqvqvrwrwrwsxsxsxsxsysyuxuxuxuxuxvytztztytytxtxtxtxtxtxtxtxryszszsztzsysysyuyvzv{w|v{w|w|w|w|x}x}x}x}x}x}x}v|w}w~v}v~v~w}v|v|w}u{v|v|w}w}w}w~v}v|w}w}w}x~x~x~w}z~z~z~z~z}z}y|y|w}x~x~x~xxxxxxx~x~xyyyz~z~z}z}|~|~}}}}{|{z{{|}}}~~~~~fosgptgptfosfosfosfosgptfoshquirvhqugptfosgptgptgpthqugptgptirvirvirvirvirvhquiqxiqxiqxiqxirvirvjswktxjswjswjryjrylqzlqzlrykqxiqxiqxhquirvirvirviqxjryjryjryjrykszjqzipyjqzipyjryjryjswjswkqvkqvkqxkqxjryjrykszjrykszjrykszjryjrykszjryjryjryjryjqzjqzjryjrykszlt{kszlt{lt{lt{lt{lt{nt{nt{pr|pr|pr|pr|nt{nt{mu|lt{mu|mu|mu|mu|mt}ls|mt}mt}mu|mu|mu|nv}mu|mu|mu|mu|mu|nv}qw~qw~qvqvpu~pu~qvqvuwuwuwuwuxvyuxvyvyvyuxvyvyvyvyvyvxvxtxtxrxrxrxrxryszu{u{szt{szszszszuzv{w|v{vzw{w{w{w{x|x|w{w{x|x}x}v}v}wv~v~v~w~v}x|x|x|x|v|w}w}v|v|v|v|x~w}w}w}v|w~w~y~y~z~z~z~z~y}z~x~x~x~x~x~x~xxxxxxx~x~yx~yy{{z~{{{{|zzz{{|}}}}~~~~~~forforfosfosgptfosfnufnudoseptfrtfrtdpreqseptfqugpthquhquhquirvirvirvhquhquhquirvirvhquirvirvjswjswjswjswktxktxktxjqzipyjoxjoxkqxjpwhpwhpwiqxiqxiqxjryjrykszkszkszjryiqxhpwiqxjryjryktxirvirvirvkpylqzjryiqxjryjryjryjryjryjrykszkszkszkszkszkszkszjryirvktxktxktxkszlt{lt{lt{lt{lt{ls|ls|nr~nr~nr~nr~nt{nt{ls|ls|mu|mu|mu|mu|mt}ls|mu|mu|mu|nv}nu~nu~nv}ow~nv}nv}mu|nv}ow~pxow~ow~ptptsutvuxuxuwuwuxuxsytztzsytytyvxvxvxvxvxvxvxuwtxtxtxtxtytytztzsysysysys{s{uyvzvzvzw|w|w|w|x}x}w{w{x|x|v}w~xw~y~y~x}x}y~y~y}y}y}y}y}z~y}y}x|y}x~w}w}w}v|w}y}y}y}z~z~z~z~z~z~z~z~z~x~x~x~x~x~x~x~x~x~x~x~x~x~yyyyzyy{{zzzz{{||}}}}~~~~fosfosfosfosfosfosfnufnufnugovgptgptgptfosfosgptgpthqufqufqufqufqugqxfpwgptirvirvirvgrvgrververvfswgtxitxjuyitxhswiqxhpwipyipyhoxhoxhpwiqxiqxjryiqxiqxiszjt{isziszhrygqxgqyhrzjswjswktxirvjpwkqxkpykpyipyjqzipyjqzipyipyjqzjqzkszkszkszkszktxktxktxjswjryjrymr{mr{msznt{nt{nt{ls|ls|ls|ls|lr~lr~ls|ls|ls|ls|ls|ls|mt}mt}mt}mt}ls|mt}mt}mt}nv}mu|mt}mt}nu~ovnu~mt}nu~nu~ow~pxovnu~quququrvsysyqyqysxsxsxtytytytxtxvxvxuwvxuwvxuwvxtxtxtxtxtytytytytyuzt{szryszuyvzv{w|w|w|w|w|v}v}u|v}v}v}x}x}x|x|y}x|x|x|y}y}y}y}y}y}y}y}y}y}z~z~x~x~x~w}w}w}z~z~y}z~z~z~z~z~z~z~z~z~x~x~x~x~x~x~x~x~x~x~x~x~yyyyyzyyzz{zzz|||||}}~~~~dprdprdprdprdosdosdosdosfosgptfosfosgptgptgptgptgpthqufqugrvgrvgrvgrvfquhquirvjswirvirvirvgrvhswfswgtxfswfswhryhrygqxgqxiqxiqxhpwhpwipyipyiqxjryjrykszkszkszjt{iszhryiszisziszjswjswjswirvhpwiqxipyipyipyjqzlqzkpykqxlryjryjryjryjryjryjrykszkszjrykszkr{kr{jqzjqzkszkszlt{lt{ls|ls|ls|ls|lr~lr~lr~lr~lr~lr~ls|ls|ls|mt}mt}mt}ot}ot}ou|ou|ou|pv}ou|qw~qvpu~pu~pu~ow~ow~ow~ow~ovovpvpvpwqxqxqxryryqxqxqxrytytytytyvxvxvxuwvxvxvxvxtxtxtytytytytytyv{v{uztyuzuzuzv{v{w|w|w|v{w|w|x}w|w|x|x|x|x|x|y}{}{}z|z|y~y~y~y~y~y~y~zzy~z~y}z~y}y}z~y}z~y}z~zzzzzzz~z~z~z~z~z~z~z~z}z}{z~x~x~yyyyzzzzyyyzz{{z||||}}}}~~~cptcptcptcptcptbosdoseptdosdosfosfosfosgpthquhquhquhquhquirviqxiqxirvirvirvirvirvirvirvjswjswjswjswjswjswjswjswjswjswirvirvjswirvirvirvirvjryjryjswjswjswjswktxjswjryjryktxktxirvirvirvirvirvjswjswjswjryjryjryjryjswktxktxjswjryjryjryjryjrykszkszlt{kr{kr{kr{kr{lt{lt{luyluyluyluyls|ls|ls|kr{kr{kr{ls|ls|ls|ls|lt{mu|lt{mu|lt{mu|mu|mu|nv}nv}nu~ovovnu~qw~qw~ow~ow~ow~ow~pxpxpxpxqypxqyqyryqxqxqxryryryrytytytztzvyuxuxvytztztytyryszsysyryryuztyuztyuzuzt{t{t|t|v|v|v|v|u|v}u|u|v}v}v}v}x}y~zy~w~xw~w~w~xzzx~x~x~x~x~x~w}w}w}w}x~x~x~x~xxxxxxxxx~x~x~x~x~x~x~yyzyyyzzzzzzzzyyz{{||||||}}}~~~~bosboscptbosbosbosdnudnudosdosfosfosfnufnuepteptfquepteptepthpwhpwhpwiqxjswirvirvirvirvjswjswjswjswjswjswjswjswjswirvirvjpukqvirvirvjswjswkszjryjswktxjswjswktxktxkszkszkszjrykqxjpwjpwkqxjryjryjswjswjswjswmsxlrwktxktxkszkszjryjryjryjrykr{kr{lt{lt{ls|ls|ls|kr{ktxluyluyluyluyluylt{lt{kr{kr{kr{ls|ls|ls|lt{mu|mu|lt{mu|mu|ot}ot}ot}ot}nu~nu~nu~nu~ovovovnu~pu~pu~ovovpwpwpxpxsyrxrxrxqyqyryryryryryryryrytztztztztztztztztyuztxuytxuytxtxtyuzwywyuzuzuzv{v|v|v|v|v|w}u}v~u|v}w~w~wwyyzzw~w~xxw~w~y}y}y}y}x~x~x~x~x~w}x~w}x~x~x~x~x~x~x~yyyx~x~x~x~x~x~yyx~yyyxyzzyyzzzzzzyzz{||||||~~~bprbprcptbosbosbosdnudnudosdosfosfosfosfosfosfosfnugovgovgovhpwhpwiqxjryjswjswirvirvirvirvjryjryjryjryjryjryiqxiqxirvirvirvirvirvjswiqxiqxjswjswjswjswjswktxjryjrykszjrykszjryirvirvirvirvjswjswktxjswjswjswjswjswlrwlrwktxluyktxjswkszkszkszlt{lt{lt{ls|ls|nt{nt{msxntyntyntyluyluyluyluylt{lt{ls|ls|ls|ls|luyluymu|mu|nv}mu|nv}mu|nv}nv}ovnu~nu~ovnv}ow~qw~pv}pv}qw~qvrwpxpxpxpxqypxrxsysytzqyrzrzqyqyrztztztztztztztztztytyryrysyrxrxrxtytytyuzuzuzwywywywyv{v{t|t|u}u}u}u}v}v}x}x}x}x}yyzzy~y~y~y~z~y}y|y|w}w}x~x~xxzzz~z~z~z~xxxxxyx~x~xxxyxxyyx~x~z{zz{z~yyyyzzyyzyzz}~~~||||}~fosfosdosdosdosdosdosdosfosfosenrfosfnufnufnufnufnugovgptgpthqthqtiruirujsvjsvjswirviqxiqxjryjryktxjswjswirvirvirvirvhquirvirvirvirviqxjryjryjryjswjswjswjswjryjryjryjrykszkszjryhpwirvjswjswjswjswirvjryjryjryiqxkszkszktxktxjswktxkszkszjrykszlt{lt{luyluyntyntyntyntykszlt{lt{lt{luyluyls|ls|ls|ls|ls|ls|ls|ls|mt}mt}nu~nu~nu~nu~nv}nv}mu|mu|nv}nv}ow~ow~qw~qw~pv}qw~pwqxpwpwqxqxsysysysysysysysysxsxtytytztztztztztztztzryryryszs{rzrzrzszszs{rzuzuzwyvxwyxzv{v{t{t{u|u|u|v}v}w~v}v}y~x}x}y~xw~w~w~w}x~x~x~w}w}y|z}zzxxxw~y~y~z~z~x~x~vvwvvvx~x~x~x~x~x~x~x~z~z~z~z~z~z~z~{yyyzyzyy{{||}}~~||||}~~~~dosdosdosdosdosdosfosfosfosenrenrfosfosfosfosfosfnugovgpsgpshqthqthqthqthquhquhquhquhpwiqxiqxiqxhryhrygqxfpwirvirvirvirvirvirvirvirviqxiqxiqxiqxiqxiqxiqxiqxjryjryjswluyktxjswirvirvgqxhryhryiszhryhryjryiqxjoxjoxlqzlqzktxktxktxjswjswjswitxjuyjuyjuyluyktxluyluyluyluykr{ls|ls|ls|lt{lt{ls|ls|lr~lr~ls|ls|ls|mt}mt}mt}mt}nu~ovnu~nu~nu~nu~mt}nv}ow~ow~ow~ow~ow~ow~pxpxpxow~ow~pwqxqxqxqxqxsxsxsxsxsxsxryryryryryryryryrzrzrzrzrzrzrzrzrzrzrzs{tytytxuyvxwywyxzv{w|u|u|u|u|v}w~w~w~w~w~w~v}w~xxw~w~w~w}x~x~x~x~x~x~x~xxxxxxw~xxxx~x~yyxxxxx~x~x~x~yyz~z~z~z~z~z~z}z}yyzyzzzzzzz{z{{{||||}|}~~~dnudnudosdosdosdosfosfosenrenrenrenrfosfosgptgpthqugpthqtgpsgpsiruhqtiruhqthqthquhquhquirvgrvgrvfswfswfswervirvirvirvjswirvjswjswirvhpwhpwhpwhpwiqxjryjrykszjswktxktxktxktxjswjryjryirvjswjryjryjqzipyko{jnzlnzlnzlqzlqzjswktxktxktxktxktxkszkszkszkszluyluyktxluyluyktxkszlt{kszkszkszlt{lr~lr~kq}lr~lr~lr~lr~lr~ls|ls|mu|mu|nv}mu|mt}mt}mt}nu~nu~nu~nu~ovow~ow~ow~pxpxow~ovpwpwpwqxqxqxqxtysxsxsxsxsxtxtxtxtxtytyryryryryryrytytytytytztzszszsysyuyuytxvzuyvztztzu|u|u|u|u{v|v|w}x|x|x}y~xw~w}w}w}w}w}w}w}x~w}w}x~x~xxxxxxxw~zzxxyyxxx~x~x~x~yyyyz~z~z~z~{{x~yzyyzyzzzz{z{{{{|||||}~~fosfosdoseptcptbosbouboucmtcmtcnrcnrforforgpsgpsfrtfrtfqufqufqugrvhquhquhquhquhpwhpwgqxgqxdsydsydsydsydsydsyjswirviqxiqxiqxiqxjryiqxiqxhpwiqxhpwipyjqzkszkszkszkszkszjryjryksziszhryhryhryhrygqxiqxhpwkmylnzlnxmoylrwmsxitxitxitxitxisziszkszkszjrylt{kszkszkszkszkszkszlt{lt{lt{lt{ls|kr{kq}kq}kq}lr~lr~lr~lr~lr~mt}mt}mu|mu|nu~mt}msntntountntovovpxpxpxow~pxow~ovpwpxqypxqyqyqysxrwsxsxsysytztztytytztztztzryryrxrxrxrxtxtxrxrxrxsyszszszryuzuzvzvzuyvzvzw{w|w|w|x}x|x|x|x|y~y~xw~x~w}w}w}w}w}x~w}w}w}x~x~xxxxxxx~x~x~x~xxxyxxxxx~x~yyzy{{{z~x~yyyzzzzzzzzzzzz{|{|||||fnufnueptdosbosbosbosbosdnudnufosfosdosdoscptdqudqudqudquervfquepteovfpwgovhpwgrvgrververvfsyfsyeqyfrzfsyfsyhswhswgqxfpwiqxiqxjryiqxhpwiqxiqxiqxjryjrykszkszlt{jryjrykszjryjryjryjryjryjryjryjryjryiqxhoxipyjryjryktxjswjswktxkszkszkszkszkszkszkszjrykr{kr{kr{jqzmr{mr{ns|ns|nt{nt{lt{lt{ls|ls|lr~lr~mt}ls|ku}ku}lv~lv~mt}mt}msntnu~nu~nu~nu~ntoumvnwnxnxnxnxnxmw~ovpwpwpwqxqxqxqxqxpwrwrwsxsxtytytytytztzrzrzryryryszryryryrytxtxsysysyrxsytzt{t{t{t{tzu{w{w{w{x|v|v|v|v|v}w~y~zw~xw}x~x~w}x~w}z}z}y|z}x~x~x~x~xxxxx~x~xyxxxxyyxxx~x~yyzy{{{{yyyzzzzzzzzz{|zz{||||||}}~fosfosfosfosfnufnufnufnudnudnudosdosdosdosdosepteptfqufpwfpwgovhpwhpwgovhoxipyhoxhoxhpwhpwgqxgqxgqxhryhryhryjryjryiqxhpwipyjqzjryjryiqxiqxiqxiqxiqxiqxjrykszkszkszjryjrykszjryjryjryjryjryjryjrykszjryjryjrykszjrykszkszkszkszjqzkr{kr{ls|ls|ls|ls|ls|lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{ku|ku|ku}lv~lv~lv~mt}mt}msntnu~nu~nu~nu~ovovououououovovpwpwpwpwpvqwqwqwqwqwqxpwrxsysysyrzrzryryryryryryryryryryryryszryryrysyrxszszszt{t{t{t{t{u|t{w{w{w{x|v|v|w}v|w}v|x~x~x~x~w}x~x~x~x~x~x~x~y|y|x~x~x~x~x~x~x~x~x~x~x~x~z~z~x~x~yyx~x~x~x~yyyy{{{{yyyyzzzzzzzzyyzz{{{||}}}~~fnufnufosfosfosfosfnufnudoseptcptbosdosdosdoseptfqufqufqueptgpthquhpwhpwhpwhpwhoxhoxgovgovhpwgovipyjqzjryjryjryjryhpwiqxiqxjryiqxiqxhquirvirvhqujryjrykszkszkszkszjqzjqzjqzjqzipyipyjryjryjryjryjryiqxjswjswjswirvkszjryjqzkr{jqzjqzkr{ls|lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{ls|ls|ls|ls|ls|ls|lt{lt{lt{lt{mu|mu|mu|mu|nv}mu|ot}ot}pu~pu~pu~pu~nu~nu~ovovovovnxnxnxnxnxnxpwpwrvswswtxrxqwpwqxqxrytysxswswtxtxtytyryryryryryryryryryryszszryszszszszszszt{szt{v{v{v{w|w|w|x|x|x|z~z~y}y}y}|~{}z~z~z~z~x~x~x~x~w}x~x~x~x~x~x~x~z~z~z~z~|~|~|~|~z~z~x~x~x~x~z~{z~{{{~}~}yzzzyyzzzzzzzz{{z{{|~~fnufnugptfosfosfosfosfosgptfosfosfosfnufnudnudnueptfqufqueptgpthqugovhpwhoxhoxhoxhoxgovhpwfpwgqxhryhryjswjswjswjswjryiqxipyhoxipyipyirvirvirvirvipyjqzkr{kr{kszjryjqzipyio{io{io{jp|jryjrykqxkqxkqxlrykqxkqxkqxkqxjryjryjqzjqziqxjryjqzjqzkr{kr{kszkszlt{lt{lt{lt{ls|ls|ls|ls|ls|ls|nt{nt{nt{nt{ls|ls|ls|ls|nr~nr~ososososptptpu~pu~mt}ovnu~nu~ovovovpwpxpxqypxpwqxswrvswswrzqyqyqyqyqytysxswswswtxryryryryryryrxrxtxtxtyuzszszszszsysyszt{szt{szt{t{t{v{w|w{w{w{x|w}v|w}w}x|y}y}z~z~z~z~z~z~z~z~z~y|y|z}z}z~z~z~z~z~z~z~z~z~z~z~z~z~{yx~x~x~x~x~{{{{{|}~{|zzzyzzzz}||}}~~~dosdosdosdosfosfosgptfosfosgptdosdosdosdosdosdoseptfqufqufquhquhquhquhqugovhpwhoxipygqxgqxgqxhryhryiszhswgrvirvjswirvjswiqxiqxiqxiqxipyjqziqxiqxiqxiqxkszkszkszkszjryjryjqzjqzipyjqzjryiqxlrykqxjryjryiqxiqxiqxiqxiqxiqxiqxiqxipyipyipyipyjqzjqzkszkszlt{lt{lt{lt{lt{lt{lt{lt{kr{kr{mr{ns|ls|ls|ls|ls|ls|ls|ls|ls|ot}ns|ot}pu~ot}pu~nu~nu~nu~ovnu~nu~nu~nu~ptptpu~qvrx}rx}py}py}pwqxqwqwrzqyqyqyqyqysxtyswswsxtytztztztztytytxtxtwtwtxtxsysysyrxryszszszt|t|s{t|v{v{v|w}w}w}w}x~y}y}y}y}y}y}y~zzzz~z~x~x~x~x~x~x~z~z~z~z~x~x~x~x~z~z~z~z~|~|~z~z~x~x~x~x~yx~{{{{{{}~{||}||zzz{{z|}}}gptfosfosfosfnufnueoveoveoveoveptepteptfqueptfqufqugrvfqufqufqufqugrvfquiqxiqxgqxhryfswerverxerxgqxhryhrygqxirvjswirvirviqxiqxiqxiqxipyipyipyipyipyipyjqzjqzkr{kr{ipyjqzkr{jqzkpylqzlrylrylrwlrwlrwkqvlrwkqvkqxkqxiqxiqxiqxiqxiqxjryhrzhrzisziszisziszkr{kr{ls|ls|ls|kr{ls|ls|ls|ls|ls|ls|ls|ls|ls|ls|mt}ls|ls|mt}mt}mt}ot}ot}nu~mt}mt}nu~nu~nu~mt}nu~ountntouqvrwrxrxsyrxrwsxsxtyqxqxqyrzrzrzryryswtxtytytytytytytxtxtxtxtxtxtxtxsysyszszszszszt{t{t{t{t{t{u|u}u}u}u}v~v~w~w~w~w~w~w~w~w~w~xxxxxxxxxxxxxzzzzz~z~z~z~z~z~{{{{yyyyyy{{{{{||{||zz{{{zzzz{}}~~~~~~}}}~~~fosfosfosfosfosfosfnufnudnueoveptfqufqufqueptfquhquhquhquhqugpthquirvhquhquirvirvjswiqxiqxhoxhoxipyipyiqxiqxirvirvirvirvirvhquiqxiqxipyipyipyipyipyipyipyjqzlqzlqzlqzmr{kszjryjryjrykqxkqxkqvlrwjswjswjryiqxiqxiqxiqxiqxjryiqxjqzkr{kszjrykszkszkszkszkr{kr{lr~kq}lr~kq}mr{mr{ls|ls|ls|ls|mt}ls|ns|ns|ns|ns|ot}ot}ot}ot}ot}pu~nu~mt}nu~nu~ovnu~ntntntntouourwqvqvqvqvrwrwsxsxsxsxsxtytytztzsxsxtxtxtxtxvxvxtytytytytxtxtxtxtxuyrxrxryszs{rzryt{t{szszszv{v{v{w|u}v~wwwww~xw~w~w}w}x~x~x~x~yxxxxyxxxxxx{z|~|~|~|~z~z~{{{{zzzzyy{{||||||{{|}z|{z{z{z}~}|~~fosfosfosfosfnufnufnufnuepteptfqueptfqufqufqufquhquhquhqugptgpthquhquhquhquirvhquirvhquirvhoxhoxhpwiqxirvjswjswirvirvirvhquhquirvirviqxiqxiqxiqxiqxiqxjqzjqzipyipymr{mr{lrykqxkpykpylrykqxlrylrykqxlryjpwkqxipyipyjryjryiqxjrykszkszjp|jp|jp|jp|jrykszkszlt{lt{lt{kr{jqzkpylqznt{nt{nt{ou|ns|ot}ns|ns|nr~osot}ot}pu~ot}pu~pu~nu~mt}ow~ow~nv}nv}nu~ovntntoupvow~ow~ow~pxpxpxqxqxsxsxrxrxrxrxtxswswswtytytytyvxvxtztzryryryszszszszszszt{szszszszszt{szszszt{v{v{v{w|v~v~www~w~w~xx~x~x~w}x~x~xxxxyxyxxxxxxyyy|||~|~yyyyyz{{{{{{{{|}||{{{|||{{{{{zz{}}}}~~fosfosfosfosfnufnufmvfmvfosfosgptfosfoshqugptgptgpthquhquhqugpthquhquhquhquhquhquhquhpwhpwgnwhoxiqxiqxiqxiqxirvirvirvirvhquhquhpwhpwiqxhpwhpwhpwiqxjrylrykqxkpylqzlqzlqzlrykqxkpykpyjpwkqxkqxkqxkqxjpwjoxjoxiqxiqxjryiqxiqxjryjryjryjqzjqzjqzkr{ktxktxluyluylt{lt{lqzlqzlqzmr{ns|ns|mt}ls|ls|ls|ls|mt}lr~msnu~mt}mt}nu~nu~nu~nu~nu~ot}pu~ot}pu~pu~pu~ptquqvqvovpwpxpxqypxqyqysxtytytytxtxtxswsxtytytytytytztztztztztzszryszszs{s{t|s{szszt{szszszszszszt{v{v{u|u|v}w~w~w~w~w~w~xy}z~zzxxx~x~x~x~yy{zzzz{yxxxzzyyyyyyzzyy{{{{{{|||{|{||{{{|{{{z}}}}~~~fosfosfosfosfnufnufnufnufosfosfosfosgptgptgptfosfosgpthqugptgptgpthquhquhquhquhpwgovgovhpwhpwhpwhquhquhpwhpwhpwiqxjpujpuhquhquhpwhpwhpwhpwhpwhpwirvirvkqvkqvkqxkqxlqzkpykpykpykpykpyirvirvjswirviqxiqxhpwiqxiqxiqxhpwiqxiqxiqxjryjryjrykszkszkszkszjrylt{kszkr{kr{jqzjqzlrymsznt{nt{ns|ns|lr~lr~ls|ls|ls|mt}lv~lv~ku}ku}ot}ot}ot}ot}pu~pu~ososntntountqvpu~qw~qw~py}py}py}qz~qyqyqxrytytyryryryrysxtytytytytytztztztzryryryryryryrzs{u{u{szszszszszszszt{t{t{t{t{v{w|v}v}v}v}x}y~y}y}y}y}zzy~zxxx~x~z~z~z~z~z~z~x~x~x~x~yxxxyx~yyyzzzzyyy{|||}}||z{{{{{{{{{~~}}}}~~~~}}}~~~dosdosdosdosfnufnufnufnufosgptgptfosgptgptgovgoveptfquepteptfqufquirvirvhquhqugnwgnwhoxhoxhpwgovhpwiqxhpwhpwhpwiqxkqxjpwirvirvirvirvirvhquiqxhpwiqxiqxjryiqxjpwkqxjrykszjryjrykszkszjswjswktxjswjswirvjryjryjryiqxiqxiqxiqxiqxiqxjryjryjrykszjrykszkszktxktxlt{lt{kszkszkszkszlt{lt{lr~kq}lr~lr~lr~lr~mslr~mt}mt}mt}mt}ot}ot}ot}pu~nu~nu~nu~nu~ovnu~nu~nu~rt~susw|tx}py}qz~py}qz~pxqysysyuxuxsxsxtytytztztztzrzrzrzrzrzrztytyuztytytyuzuzuzuzuzuzt{t{t{szsysyvzvzuyvzxzy{x}w|y~y~y~y~y}z~zzzzzy~z~z~z~z~z~z~z~z~z~z~x~x~x~x~xxxx{zz~z~{|zzyyyy{{|{|{|{|}|{{{zz{||{{{}}}}||}}bosbosdnudnudosdosfosfosfosfosfosfosfosgptgpthquhqugptfqueptdquervervdqueowfpxhoxgnwgnwhoxgovhpwiqxiqxhpwhpwipyhoxirvirvirvirvirvhquirvirvgrvgrvhswgrviqxiqxiqxjryjrykszjrykszktxktxjsvjsvjsvjsvirvjswiqxiqxkpyjoxipyipyiqxiqxjryjryiqxiqxjryjryjryjrykszkszlt{lt{jt|jt|jt|jt|jt|jt|js~js~kq}lr~lr~lr~lr~lr~lr~lr~ls|mt}mu|mu|mt}nu~ovnu~nu~nu~nu~nu~nu~nu~nu~ovow~pxpxpxpxpxpxpxsysysysyqyqyryryrzrzrzrzrzrzrzrzrzrzryryryrytytytytytyuzuzuzuzv{uyuyuyuyuyuyvzvzw{w{w{x|x}y~x}y~y~zzzy~zy}y}z~z~z~z~x~x~x~x~x~x~x~x~x~x~yx~x~x~z~z~z~z~{|||{{z{{{{|{|zz{{{{zzz{{|{{}}}}}}~~~|v~r|lv~dosdosdosdosfosfosfnufnufosfosfosfosgptgpthquhquhquhqufqufqudquerverxdqwfpxfpxfpxfpxhnzhnzhoxipyhpwhpwgovgovhpwiqxhquirvhquhquiqxiqxiqxiqxiqxjryiqxjryiqxjryjryjryjqzjqzkszlt{luxluxktwjsvirvirvjswjswiqxjryjryiqxipyhoxipyhoxjryjrykszjryjryjryjrykszkszkszlt{lt{jt{jt{jt{jt{jt|jt|jt|jt|ls|ls|ls|ls|lr~mslr~lr~mt}mt}mt}ls|mt}mt}mt}nu~nu~nu~nu~nu~nu~nu~ovovovpwpwovovpwsxsxsysysysyqyrzrzrzrzqyrzqyrzrzrzrzrzrzs{s{s{rztztztytytytyuzuzv{v{uztyuyuyuyvzvyvyxzxzw{x|y}x|y}z~w}x~x~w}w~w~zy~z~y}zzzzxxxxx~x~x~x~z~z~z~z~z~z~x~x~yyyx~x~x~yyyzyzzz|{||z{zzz{{{{{{{}}}~~~~}|dosdosdosdosdosdosdosdosdosepteptepteptfqugrvfqufqugrvfqufqufqugrvfqufqugqxfpwipyipyhrzgqygqygqygqyfpxhoxhoxgqxgqxfpwgqxfqugrvirvirviqxiqxipyipygqygqygqyhrzis{is{kszkszlt{kszluyktxktxktxjswktxjryjryjryjryjryjryio{io{hnzio{jqzjqzjryjrykszjrykszkszlt{lt{jt{jt{jt|jt|jt|jt|ls|ls|mt}ls|ls|ls|ls|ls|msmsmsmsmslr~lr~msnu~nu~nu~nu~mt}mt}ososmsntntntovovovnu~ououpvqwqxpwpxqyqyqyqxqxryqxrxqwryryryryryrytytyryryryryryryryrysyrxsysytzrxsyrxuyuyuxvyvzw{v|v|w}v|w}x~w~xxxw~xxxxxxxxxx~x~x~x~x~x~x~x~x~x~x~x~x~x~x~x~yyyx~x~x~yzzzzzyy||zzz{{{{{|{{|}}~~}~~~~}~~fosfosfosfosfosfosfosfosdoseptfqufqueptfqufqufquhquhquhquhquhquhquiqxgovhpwhpwiqxiqxiqxiqxhpwiqxhpwiqxirvirvirvirvhquhquhquirvjswirviqxiqxiqxiqxiqxiqxjryjrykr{kr{kr{kr{jqzkr{kszkszktxktxktxjswjqzipyipyipyjqzjqzipyjqzjqzjqzkszjrykszjryjryjrykr{ls|lt{lt{lt{lt{lt{lt{ls|ls|ls|ls|ls|ls|ls|ls|mt}mt}nu~mt}mt}mt}mt}mt}msmsmsntnu~mt}mt}mt}msntntntmsmsntououououpvpvpvqxqxqxqxqxqxpwqxrxqwqwrxtytytytytytytztztztztztztytyryszsysyt{t{s{s{szszsytztztzu{u{v|v|v|v|y~zzzyzzzxxxxxxxxx~x~x~x~yx~x~x~x~x~yx~x~x~x~x~z~{{z~{{{|yyzz|||||||}{{zz{{}}{{{|||~fnufnufmvfmvfosfosfosfoseptepteptfqufqufqufqufqueptfquhpwhpwhquhquirvhquhquirvirvirvirvirvirvirvhquhquirvirvhpwhpwhpwhpwhquirvirvirviqxiqxiqxiqxiqxiqxiqxjrykszkszkr{jqzjrykszmszmszmszmszmszlrylrykqxiqxiqxiqxjryipyjqzipyipyjryjryjryjrykszkszkszlt{lt{lt{ktxluyluyluyls|ls|ls|ls|ls|ls|lt{lt{mu|mu|mu|mu|mt}mt}pu~pu~msmsnu~nu~mt}nu~nu~mt}nu~nu~nu~nu~ntouovovqw~qw~qvrwrwsxqypxqyqyqxpwpvqwqwqwrxrxryrytytytytyryszszszszszryszuzuzsysyt{t{szsztztzsytzszu|w|x}x}x}y~y~zy~y~y~zzzzzy~y~y~zzzzx~x~x~x~yx~z~z~z~z~z~z~z~z~z~z~z~{{|{{||yyzzzz{zzzz{}}}}}}|{{||{|}fmvfmvfnufnuforfordprdpreqseqsfqufqufquepthquhquhquhquhpwhpwirvirvirvhquhquirvirvirvirvhquhquirvhquhquhpwhpwiqxhpwiqxhpwhpwhpwhpwhpwipyipyipyipyipyipyjqzjqzjqzjqzlqzmr{mszlrylrykqxkszjrykszkszlryjpwkqxkqxiqxjryjryiqxipyjqzjqzipyipyjqzkr{kr{kr{ls|lt{kszlt{kszlt{lt{lt{lt{lt{lt{ns|ns|nt{ou|nt{ou|ou|ou|ns|ot}nu~mt}mt}ovow~nv}nv}nv}mu|mu|mt}nu~ovovovovntntptqusutvrwrwpwqxqxqxqxpwpvqwqwqwtxtxtxtxtxtxtyuzszt{s{t|t|t|szszuyuyuzv{t{szsysysytzv{v{t{u|u|u|v}v}y~y~{}{}|~|~zzzy~y~y~w}w}xxxyxxxxyx~x~x~x~x~x~x~xxxxyyzyyyyzzz{z{{{{zz}}}}}}||{|{{{{~cptdqucqscqsbprcqscptcptepteptfqufquhquhquhpwhpwhpwiqxiqxiqxiqxjryirvhquirvirviqxhpwiqxiqxiqxhpwhpwiqxiqxiqxirvirvirvhquhpwhpwiqxiqxiqxjryipyipyhoxipyjqzjqzjp|jp|kq}kq}kr{kr{jqzjqzkszkszkszkszjqzipyipyipyirvjswjryjryipyjqzjqzjqzjqzjqzjrykszkr{kr{kq}kq}kszkszlt{lt{ls|ls|lt{lt{lt{lt{lt{mu|mu|lt{ls|mt}mt}mt}mt}ls|mu|ow~nv}nv}ow~nv}nu~nu~nu~ovovnu~ououououovovqvrwrwrwqxqxqxqxqxpwsxsxrwrwtxtxrxrxryszszryszszt{szt{t{t{szszszt{szt{t{t{t{uyuyuyvzvzw{w{w{x}y~y~y~y~zzzy~zy~y~z~z~xxxxxyxyxxyyyyyyyx~x~x~xyzyzzyzzzzzzzzzzz|}|}}}||{|{|{{{{~~~~~~~~~drtdrtcptboscpvcpvdosdosdoseptgptgpthpwgovhpwhpwhquhqugovhpwiqxiqxiqxiqxhpwgovgovgovgnwhoxhoxhoxhoxipyipyipyiqxiqxiqxiqxiqxiqxhpwiqxiqxiqxhoxhoxhoxipylqzlqzlqzmr{ls|ls|lt{kszkszkszktxktxkszjryipyipyiqxiqxiqxiqxipyipyipyjqzipyipyjqzjqzis{is{ir}ir}kq}kq}kszlt{lt{lt{ls|ls|nt{nt{nt{nt{mu|mu|nu~mt}ls|mt}mt}mt}mt}mt}nv}nv}mu|ow~ow~ow~ow~pxpxpxpvntouououpvpwpwqypxpwpwsxsxsxrwsxsxsxsxuwuwtytyryryryryryryuzuztxuyuzuzu{v|uzuzuzuzuzv{v{uzwywywyxzw|w|v{w|x}x}x}x}x}y~zzzzy~zzzzy~z~z~z~{yxxxzzz~z~xyyxx~x~z~{{{{|zzzzzzzzzz|||||}}}}}}~~}}}~~epteptdqucptcptbosdosdosepteptgpthqugovgovhpwgovgovgovgovhpwhpwiqxhquhquhpwgovgnwgnwhoxipyipyhoxipyhoxhoxhoxipyipyirvjswirvirvirvirvirvirviqxhpwhoxipyjp|jp|kr{kr{lt{lt{luyluyktxktxktxktxktxjswksziqxhpwiqxiqxiqxjryjryjryjryjryiqxiqxjryisziszis{jt|is{is{isziszkr{ls|ls|ls|lt{lt{lt{lt{mu|mu|mu|mu|mt}mt}nu~mt}mt}mt}nv}ow~nw{ox|ox|ox|ow~ow~ovovovovouououpvpwqxqxpwrwsxtysxsxsxsysyvyuxuxvytytytytyryryryryrxsytxtxtxuyuzv{v{uzt{t{szsztzsyuyuyuyvzv{v{v|w}w}x~y~x}w~w~x~w}xxw~xxxxxz~z~z~z~zzxxxy{z~z~z~|~|~|~|~z~{{{{{||||zzzzzzz{}|}|}}}}}|~}}}~}~}~~}}~eoveoveptepteovdnudnueoveptfquepteptgovhpwhpwhpwgnwgnwhpwhpwhpwhpwhpwhpwhpwgovgnwhoxhoxipyipyipyhoxhoxhoxipyirvjswjswjswjswirvirvirviqxiqxiqxiqxhpwiqxiqxjryluyluyluyktxlt{lt{kszlt{luyktxktxktxjryjrykqxkqxhpwiqxjqzjqzjqzipyjqzjqzjrykszisziszis{is{ir}ir}ir}ir}ls|ls|ls|ls|ls|ls|lt{lt{mu|mu|ou|nt{mu|mu|mt}mt}msmsntntnv}ow~nv}ow~ow~ow~mwmwnxnxnxoyqxpwqxqxqxqxqxqxsysyrzrzrzrztytytytyvxvxtytyryryryrysyrxtxtxuzuzv{uzv{v{t{t{t{t{t{szuyuyuyvzv{v{v|w}z}z}x}x}v|w}w}w}x~x~x~x~x~x~z~y}|~|~|~|~z~z~xyyyyx{{z~z~z~z~yyyy{{{{||zzz{zz{{|||}}}}}}|||}}~}~~~gptgptfosfosdnudnueovdnudnudnudnudnufnugovgovgovgovgovhpwhpwhpwhpwhpwhpwhpwgoveovfpwfpwgqxerxerxerxdqwerxerxgqxgqxhswhswirvirvhquhquipyhoxhpwhpwiqxiqxjrykszktxluyluyluylt{kszkszkszkszkszjryjryjryiqxjoxjoxhoxipyipyjqzjqzjqzkr{kr{kszkszkszkszjqzjqzjp|kq}kq}kq}kr{ls|ls|ls|mt}ls|ls|ls|ls|ls|lt{mu|mt}mt}msmsmsntmt}ovovovovpwpwovouououpvpwpwpwqxqyqyqypxpwqxqxryryryryryrxrxrxrxryrytytyryryryszsyrxsysytztztzsysytzvzuysytzu{tztztzvzvzvzvzxzy{z|y{x|x|v|v|w}x~x~x~x~x~x~x~x~w}z~z~z~z~z~z~yyyyxy{{{{z~z~yyzzyyzzzzzz{z}|{{zz{{}}}}}}}}}}}}~}~~eovdnufnugovfnuhpwgovgovgovgovgovfnufosgptgptgptgpthquhquhquhquhquhpwiqxhquhquhpwhpwgqxgqxfqugrvgrvgrvfpwfpwipyipyjswirvirvhquhpwhpwhpwhpwhpwhpwiqxhpwiqxjrykszkszktxluyluyktxkszkszktxluyktxjswjswjswkqxlryiqxiqxjqzkr{kszjrykszlt{kszkszjryjryjqzjqzkq}jp|kq}jp|kq}lr~lt{lt{ls|ls|ls|ls|ls|mt}mu|mu|mu|nv}ntounu~mt}nv}nv}nv}nv}nv}nv}ntouououow~pxpxqypxqyqypxqvpu~sutvsxtyrzrzryryryryryrytytytxtxtxtxrxsyrxrxt{szu|t{v{uzuzuzxzwyuzuzu|u|u|u|tztzw{w{v{w|z|z|x}x}x}y~y}z~x~x~x~x~x~x~xxxxyxzz{{{|{{{{yyx~yyzzzzz{{zz}||}}|}|zz{{{{~}~~~~}}}~}~~~fnugovfosfosgpthqugptgptgptgpthqugptgptgptgptgpthquhquhquhquhquhquirvhquhquhquhquhquhquhquirvirvirvhquhpwhpwgqxhryhswgrvfqugrvhpwhpwhpwgovhpwhpwiqxiqxjrykszkszlt{luyktxluyktxlt{lt{luyluyktxktxjswjswirvjswjryiqxkszkszktxktxktxktxkszkszjryjrykszksziqxkszkszkszls|ls|ls|ls|ls|ls|ns|ns|mvzmvzluyluymu|nv}ovnu~ow~mu|nv}ow~ow~nv}nv}nv}nu~ovpxow~ow~pxpxpxpxqypxpxqvrwrwsxqxqxryryryrytytytytytxtxtxtxtytytytytxuytxuyv{w|v{v{uzuzwywyuzv{v{w|w|w|vzw{w|w|w|w|x}x}x}x}x|y}y}z~|~|~|~|~zzxxx~x~xxyyyyzyyy{{zzyyzzzz||}|}}}}}~}|||{{||~~}}}~||||||{|~gptgptgptgptgpthqugptgptgptgptgptgptgovgovgovhpwhquhquhquhquhquhquhquhquhquirvhquhquirvhquiqxiqxhoxhoxjoxjoxjryjryhswhswiqxhpwhpwhpwhpwhpwiqxiqxirvjswluyluyktxluyktxluyluyluyluyluyluyluymsxlrwlrwlrwjryjrykszjryjrykszktxktxktxktxkszkszkszkszkszkszkszkszlt{kszls|ls|ls|ls|ls|ls|ls|mt}mvzmvzmvzluymu|nv}ovnu~nv}ow~ow~ow~ow~ow~nw{nw{ow~ow~ow~pxpxpxpxpxpxqypxqyrwrwsxsxsxsxswswswtxtxtxvxvxvxvxtytytytytytyuzuztxuyuyvzxzxzwyxzwyxzu{v|u}u}u{tztzu{w}w}w}w}w|w|w|y~{}{}y}z~zzzyzzz~z~{z~z~z~{{yyyyx~x~yx~x~x~yyzzzz{|||}|}|}}}||}|{|{}}~~~~||||{|||hpwgovfnufnufnugovhquhqugptgpthquhquhoxhoxgnwgnwhpwiqxirvirvirvirvirvirvirvirvirvirvhrygqxgqxfpwipyipyhoxipyipyjqzjqzipyipyipyjryiqxiqxiqxjqzjqzjrykszluyluyjuyjuyjt{jt{jt{jt{lt{lt{lt{lt{mszmszlrymszkszkszkszkszjt{jt{juyjuyjuyjuylt{lt{ls|ls|ls|ls|ls|ls|ls|ls|mu|mu|mu|mu|lt{mu|mu|mu|mu|mu|mu|mu|nv}nv}nv}mu|nw{ox|ox|ox|ox|ox|ow~ow~ow~ow~pxpxqypxpwpwqxqxryqxqxqxqxqxqxryrxrxryryryryryryrxrxrxsyszszryrysysyuxuxvyvytztztzu{t{szt|t|t|u}u|u|u|t{u~vx~w}w|w|z|z|z|{}w}x~w}w}w~w~zz{{{z~z}z}z~z~yzyyyyyyyyzzzzzzz{{{}}}}{{{|||{{|{}}}~~~}~|}||||~govfnufnufnugptgptgptgpthquhqugpthquhpwhpwhpwhpwfpwfpwgrvgrvgrvhswhswgrvirvirvgrvhswfswfswervervfpwgqxgqxgqxiqxiqxiqxjryiqxiqxiqxiqxiqxiqxjqzjqzkszkszlt{lt{lt{lt{lt{lt{ls|ls|nt{nt{msxntymsxmsxmszmszkszlt{ls|ls|jt{jt{juyjuyjuyjuyluyluylt{lt{ls|ls|ls|ls|ls|ls|ls|ls|mu|lt{lt{lt{ls|mt}ou|ou|mvzmvznv}nv}nv}nv}ox|nw{ox|ox|ow~ow~nv}nv}ow~pxpxpxqypxpxpxqyqyrzrzqyqyrzqyqxryryryryryryszryszszszszszuztytytyuzuztzu{u{tzu|u|v}u|v}u|u|u|u|u|u{u{v}u|u}v~x~w}z}z}{}{}z~z~x~x~x~x~xxzzz{{{z}z}{z~{{{|||zzyzzzzzz{{{|||||||||}}|||{|{|~~}}}}~~~~~~gptgptgptgptgpshqtfrtfrtfqufqufqufquhquirvhquhquhquhquhquhquirvhquhquirvhquirvjryjryjswirvhquhquiqxiqxiqxjryjryiqxiqxjryjryiqxiqxhpwjoxkpylqzlqzkszlt{lt{lt{lt{lt{kszlt{ns|ns|nt{mszntyntyluyluyluyluykszkszlt{lt{lt{lt{luyluyluyluyluyluyluyluyls|ls|ls|kr{lr~lr~lt{mu|lt{lt{ls|ls|ns|ns|lt{mu|mu|mu|nu~nu~nv}nv}nw{ox|ox|ox|ow~ow~nu~pwpxpxpxpxqypxpxpxqyqyqyqyrzqyqyqyryryrzrzrzrzryrytyuzuzuzuzuztytytxtxvxwyuyvzu{u{tzu{u{v|u|u|u|u|w|w|x|w{w|w|y|y|y|z}z|z|{}|~{}{}z~z~yx~xxzz|{{{{~{~{{{|{|~||||}|}}{{z{{||||||||}}}~~~~~~~~}~||||~~~gptgptgptgptgpthquhquirvhquhquiqxiqxirvhquirvirvirvhquiqxhpwhoxhoxhoxhoxhpwiqxiqxiqxiqxiqxirvirvirvirvhpwhpwipyjqzjswktxjswjswiqxiqxipyipykr{kr{kszkszlt{lt{lt{kszls|ls|ls|ls|lt{lt{ntyntyluyluyluyluyktxluylt{lt{ls|ls|lt{lt{lt{lt{lt{lt{lt{lt{ls|ls|ls|ls|ls|ls|mt}ls|ns|ns|nr~nr~nr~nr~ls|ls|mt}mt}mt}nu~ow~nv}nv}ow~ovovovpwovpwpxpxpxqyqypxpwqxqyqyqyqyqyqyrzrzrzrzrzrzryrytytytyuzvxwyvxvxvxvxtxtxuyuyuzv{w|v{v{v{w{w{u{v|v|u{u{u{wzwzx|w{y{z|y{z|z|z|{}{}{}{}z~z~z~z~z~z~z~{z~{||{|{||{|}||{zzz}}|}{{{z|||{||||}}}|||~~~~~~~~~|||}~~~~~govgovhqugpthquirvfqufqugqxgqxgqxfpwgrvgrvirvjswhswhswgqygqyhq|gp{gp{gp{hoxipyipyipyipyipyiqxiqxiqxiqxhoxhoxipyjqzjryjryiqxiqxipyjqzjqzjqzkr{kr{kr{ls|ls|ls|ls|kr{ls|ls|ls|ls|lt{lt{lt{lt{kszlt{lt{lt{kszkszkszlt{lt{lt{lt{lt{ls|ls|ls|ls|ls|ls|jt|jt|jt|jt|jt|jt|lr~lr~lr~lr~lrlrlr~lr~lr~lr~lr~lr~mt}mt}nu~nu~ovnu~nu~ovpwpwpxpxqypxpxqypwqxoypzoyoyoyoyqyqyrzrzrzrzrzrzryrytxtxtxtxtxtxtxtxuytxtxuysysysytzsysytzu{u{u{u{v|v|v|v|v|u{u{v|u{u{v|v|v|v|v|w}w}w}x~z~z~z~z~z}z}z~z~x~yzz|||}zzzzzzzz{{{{|{{{|{{|{|||||}}||}|~~||}}~~~}}~~~~~~~govfnugovgoveovfpwfpwfpwgqxgqxiqxhpwhpwhpwhpwhpwiqxjryiqxiqxipyjqzio{hnzio{io{io{io{jp|io{iqxhpwiqxiqxipyhoxipyjqzjryiqxhpwhpwiqxjryjqzjqzkq}kq}ls|ls|lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{lt{kszkszlt{lt{lt{lt{lt{lt{ls|ls|ls|ls|ls|mt}jt|jt|jt|jt|ls|ls|lr~lr~nr~nr~msmsmsmsls|mt}ls|mt}ow~ow~ow~ow~ow~ow~ovovpwpwpxpxqyqyqypxpvqwrxrxqxryryrysxtytytyrzrzrzs{rxrxsyrxrxsytyuzuzuzuyuyuyuyuyuyvzuyuxuxvzw{w{vzvzw{v|v|v|v|v|v|x|w{w{w{x}x}v}v}v|w}x~x~xxx~yz~z~z{yyyz|{|}|}||||{{zz{{{{{|{|{|{{~~~~}}}|~~|||}}~}~~~~~~~fquepteptepthquhqugpthqugpthquhpwhpwiqxgovhoxhoxiqxjryiqxiqxiqxiqxipyipyipyjqzjp|io{io{jp|jryiqxiqxiqxipyipyipyipyio{hnzio{io{jryjryjrykszkszkszls|kr{lt{lt{lt{kszkszkszls|ls|lt{lt{lt{lt{lt{lt{ls|kr{kr{kr{luyluyluyluylt{lt{mu|lt{mu|lt{lt{mu|ku|ku|jt|ku}ktktksjrmsmsmt}mt}mt}mt}ls|ls|mt}mt}ovovovovpwpwovnu~oupvrwrwrwsxrwrwpvqwryqxqyqytytytytytxtxryryrzrzryszszszsysyrxsyuytxtxuyuyuyuzv{uzuzuyvzvzvzw{w{vzx|v|v|u{v|w{x|x|w{z|y{y|y|z|z|z|{}y}z~x~x~x~yyyxxxy{{zz|}}}}}{{{{{z{{|{}}}~}}}}~~~~~}}}}}}}~~}}|}~~~~~~~fqufqufqufquirvhquhqugpthquirvirvhquhquhquhquhquiqxhpwkqxkqxkqxkqxiqxiqxipyipyjqzjqzjryjryiqxiqxiqxjryjryjryjqzjqzjqzjqzjryjryktxktxktxktxlt{kszlt{lt{ntyntyntymsxlt{kszls|ls|lt{lt{luyluyluyluylt{lt{luyluyktxktxluyluyluymvzmvznw{luymvzmvzmvzlt{lt{nu~nu~ovovnu~mt}ovmt}mt}mt}mu|nv}ou|pv}pv}pv}ovnu~ovovpwpwpwpwpwpwpwqxsxsxqxqxqxrysxsxsxtytytytytytytytytys{rzszszszszt{szt{t{szsztxuyvzvzv|v|w}v|v{v{t{u|u{u{u{u{wzwzw{w{w|w|w|x}x~x~w}yx}y~x}y~w}x~x~x~xyzyxxyz{{zz}}}}|{{{{{{{{|}~{|||{{||~~}}}}}fqufquhquirvjryiqxirvhquirvhquhquhquhquirvirvirvhquirviqxiqxiqxjryipyipyipyjqzjryjryjryjryjryjryjryjryjryjryjryjryjqzkr{kszkszktxktxluyluyluyluyluyluyluyluyluyluylt{lt{lt{lt{lt{lt{lt{lt{lt{lt{ls|ls|ls|ls|lt{kszlt{lt{mu|mu|mu|lt{mu|lt{lt{lt{lt{mu|nv}ow~ovovovnu~nu~nu~ow~nv}nw{ox|ox|ox|ow~ow~ovovpwpwqxqxqyrzqyqyrzrzrzrzrzrzryryrzrzrzrzrzrzrzrzrzrztztztyuzuyuyuyvzt{t{t{t{t{t{t{t{u{u{u|u|u|u|v}v}v~v~v}v}u{u{v|v|v}v}v}v}v~wwv~wxw~xxxx~x~x~x~yy||{{yzz{|}}}}~{{|||{|{|||||||||||}}}}~}}}}}}}}}}}}}~}}hquirvirvirvirvirvirvirvirvirvirvjswjswirvjswirvhpwjryjswktxktxjswjswjswjswluyjuyitxitxitxitxitxhryiszlt{kszktxjswlt{lt{lt{lt{ktxluyluyluyluyluyluyluyluyluyluyluyluyluylt{lt{lt{mu|lt{lt{lt{lt{ls|ls|ls|ls|ls|ls|ls|mt}mt}mt}ls|mt}mt}mt}lt{lt{ou|ou|qw~pv}ow~ow~ovovovovow~ow~ow~pxpxpxow~ow~ovpwqxqxqxryqz~r{r{r{r{r{r{r{r{r{rzrzrzrzrzrzszszs{rzs|r{uztyszszt{t{t{t{uzv{u|u|u|u|u|t{u|t{u|u|v}v}v}v}v}v}v}v}w~w~w~v}v}v}v}v}v}w~w~w~xxxxxxxxx~yyzz{zzzz|}~~|}|||||||||||}|}}}}}}}~~~~~~}~}}~~~~~~~~govhpwhpwiqxhpwhpwhqujswjswjswjswjswhswitxhswhswhswhswitxitxitxhswitxitxitxitxktxktxjswktxitxjuyjt{jt{itxitxitxjuyluyluyluyluyluyluyluyluyluyluyluyluyluyluyluyluyluyluylt{lt{lt{lt{lt{mu|mu|lt{ls|ls|lt{lt{lt{lt{ls|mt}ls|mt}mt}nu~nv}mu|nt{nt{ot}pu~qw~qw~qw~qw~pv}qw~pxow~ox|py}py}py}pxpxpxpxqyqyrzqyqyqyr{r{r{r{rzrzs{rzrzrztztzszszszryszszs|s|s|s|s{s{t|t|t{t{t{t{t{u|u|u|v}t{w|w|w|w|u|v}v}v}u}v~u}v~v}v}y~y~y~y~y}x|x|x|w}w}x~w}w~xzzzzzz{{{|zzzz{{||~}}}~~}}||||~~~~~~~~~~~~~~}~~~bpzaoy`nves{bqwcrxht|frzdnvhrzis{hrzeqyfrzes{cqydrzdrzcowdpxfpxhrzis{fpxiqxiqxfnufnueoviszhu{hu{fsygtzeqyeqyjt{ku|juyitxiqxkszipykr{jryiqxiqxlt{kr{kr{kr{ls|ls|ls|kr{ls|ls|ls|ls|kr{kr{ls|ns|ns|jp|kq}lr~lr~mt}mt}ls|kr{ls|ls|ls|ls|mt}nu~mu|mu|lr~lr~msntpwnu~pwovow~pxow~pxpxow~qxpwpwqxqxpwovryqxqxryryrzrzryrytzu{u{tztytyryryryryszszuzv{szt{t{t{t{t{t{t{u{u{tztztztzu{u{w{w{w{w{w|w|v}v}v}u|v|v|v}w~w~w~y}y}x|y}y}y}y}x|x{y|{}{}zzzzzz{|zz{{{{{{{{||~~}~}|}}||}}}}~~~~~~~~~~~~~~~~~~~~~~ow~mu|juyjuyhswgrviszdnuemtiqxhoxfmvcjshoxhu{bou_nt`ou`oubqwdnufpwfpwdnufosfosdlsaipdnvhrzdpxcow`ltbnvdjvbhtipykr{jswbkoYem_ks[go`ltakr[el`gphoxfmvfmvelugnwipyfmvfmvhoxfpxdnvfpxdnvekwflxgmzio|aivfn{dmxbkvjs~ktfnudlsjqzjqzhnzflxhnzkq}ls|ipyagtjp}io|hn{nqmp~mskq~iqxnv}luyluyjrykszls|jqzls|pwpwls|kq}msiq~hp}ltmujt|ku}oxlumt}ovrxqwntmsntoulr~ourxpvqwsyqzs|s{qypxpxtzw}w}u{szu|ryrytzw}x~w}v|u{u|w~us}u~u~s{s{t|u}w}v|w}w}w}x~x~x~w}w}v|u{w}w}v|x~x~w}x~yzzwv~wyyyzzz|{||||}}}|}}}}}}}~~}}~~~~~~~~~~~~~~~~~~~z|z{xxy{wy||zv~yzz}{xv~xwv~yy|u}oz~vpzq{vs|r{u~t{t{uzsxtzx~t|rzq{s}nxmwmwpzryszovqxqwkq}ovryhpwiqxmssyrxmsimyosw{qulp|txruorko{nr~mslr~hoxls|mvzktxot}qvls|kr{nu~ovjp|gmyqwjp}dlyjrmultgp{lunwhq|jp}lrio|kq~ntmskq~lrkq~lrlrlrrxouel|hojqhokrfm}in~pukq~jp}ntouio{lr~ntpvrxkq~lrlrmsountmsnsmrkolpqvsxpvpvrump~orqtvwstmp~nqlo}qtsuoq}oq}rtrupsmpqtsxrwpvmsmsouqvrwpuotototqwqwnqrutzv|sypvqwtzx~w}tzv|tzrxv|x~v|w}w}tzv|w}{|yzxy{|z~y}x|uyx~{yx~w}w}x~{}}|zz~y}z}uyw{z}z}}~}|||{{~~}zx|}~~{~|x~zx~v||}|x}t{w~zu|y{~|~y{u{zyv|u}t|ryu|w|uzxzz|zzuzrwzytsrq~wvtwqttwtwpspspqrsvwrspqqrop~pqrxlrlo}mp~rqqp~op~no}lo}orruhkyortwlm{stuvmn|rqon|lkylkyno}lm{nnpppqqruton|nm{srrn{xtvusrmsountkq~lqmrbizbizkrdk|gn~mtjp}kq~lrpvpusxkpin~rwothm}joouqwnr~qump~lo}twqtnsrwpujonsrwrxlrkq~qwtztzpvrxruorrsrsqttwsxuzvytwtw|mtkrpwnulsnus{rzrxrxtzu{rxrxvyy|z~x|}|yzw}x~w|y~|{yzy~}~~~~{x~z}~~}{z~~~~}~~}|}}}z}~|~~}|~~||}}~~{|yz~|z}y|z}z}||{{~~x||~v|}}x{~{||}xy{}|~{||}yz|}{||}{|x{y|x{y|vyz}{}|uxy|z}{~{~y|x{y}|{w{x|}}z}x{z}}}|~~tw}~ºùº¼¾¾Ľýþ¾¾ĺ~{}z~|~~~Ŀ½þþĿɽɿŽÿſǾĹùùźƵ¶~}|z}wzvzz~{x|wywyxystmnkluu}}vvlluuvvvvssuvz{vyz}x|x|z}rusvsvtwuxv|tznvowoxqzxwmyr~p|nzxyx~syrwz{|ypys}vz}~x~|{y~|~~}|~z{|~~}{vwszpwpwovmuowpyqz|ſž¿ȿȾǸȶƶȷɵŲ¬´è{}|~w|rvw{{z~}yirfopxv~mufnemiqozr}t|t|y|tylqltpxr{r{q{lvjulwnyp{nzr~tjvkvoznzq}htlxnys~p~m{ivbocpkxp~m{ozjumvnwlwjumvnwgrozpzoys}s}rp}m{hvkwr~mzlyp|r~p~rrvspxzxx}xsvvxr~sw}|xn{tyz{|~~~~~nxoymyjvlxlxhtjvrzowsyu{q|q|n{fskr{kr{jpwiovps{vyuwpr~qp}utur|xuyv{x~~||qz~vxv~y}w{|}~{z~~}~|~}~¿¿¿ſý˾ɾɾɿƿþŹu~~xxy}ywtx||}ytr}tyzw~{w~yvzzzyrywqo~x|zyzzz~w~wqzp}vvvyy|zzyxxvsttrix[j}KZmJXgFTcHUaHUaMWdT^kOXiIRcKTeQZkNUeKRbKRcQXiV`oPZiHV`KYcKXdMZfT]nNWhSWiPTfSSdTTeWViSReLPbJN`QTiNQfHK`ILaMPeMPeGMZIO\PVcOUbSBE[GJ`;@P?DTFI^JMbAB]?@[JKfHId?>SHG\MI_IE[89N@AVDEZABW@=P=:M>:PEAWJBZH@XOG_OG_MF\SLbVMaQH\LFXXRdYWhYWh`Zm\ViXRd[Ug_Zi\Wf\Wf\Wfhbtf`rd_nhcrjcrhapg]mmcsohwqjyrkzqjyqjysl{yt{vyt{v~wzsuu}tvyzzv~¹żŽü»ºƾƾºſûѾͿξ͹ȸǵĸǶŵǹ˻ͶȴƵǵųóųŰòŲıïí}~{}}xwssqpnl~cuap|[jvdozcnydqwcpvboucpvbqwapv`oudsyhryeovdnvgqyfrzcoweqyeqybnvfrzjt|jt|eowdnveowhrzis{fpx`nx`nxanz^kw_iv`jwdlyaivaivbjwblybly\fs[er\fu\fuV]mX_oX_oW^nR\kT^mT_pR]nOXiOXiU\lT[kLTaOWdQXhQXhPXeOWdOTdSXhSWiIM_NPbQSePRdOQcLN`NPbPTfOSeSWiSWiMPeMPeIK]HJ\IK]KM_KM_HJ\PSiMPfGJ_JMbPQfKLaIK]JL^ONaONaNM`PObQPeMLaIJ_JK`KQeFL`IIbHHaPH`PH`PJ]MGZMI_KG]MI_KG]NH[E?RD=SIBXIBXJCYLFYNH[NGVLETLCYG>TE8SL?ZK;XL:XA6WE:[K>_C6WA6WH=^M>dJ;aJ;[J;[L:\TBdQ?aK9[F9TF9TMD`G>ZK=aM?cQeHHgJJiMMlHHgGFhLKmKOnFJi;B`ELjHGiDCeVJnSGkK@aI>_B=dUPwLLjLLjMMkCCaHHgSSrUToXWre_{_Yu\XvWSqGGfMMlWRrOJjYOncYxh_{d[waWvbXwh^}lbgYvgYvkamclhnjhb~ke{sumrmojsn{v|~yyþĽúººŽ|zvuppnjd|^vfxhzrq~tvuwttvr}svtxxtwvvxxxzywxsqrrqpqqol|m|o~p{oznynyn{mzjykzizhyfzfzfyexev}ev}ev}du|du|du|ft~es}es}dr|drzdrzcqybpxcq{cq{cq{bpzanzanzanzanzanzanzdn{cmzblycmzanz`my`my`my`my`my`my`my`my`my`myanzaoyaoyaoyaoyaoy`nx`myanzanz`my`my`myblycmzcmzblyblydn{dn{cmzdn{dn{bo{bo{bo{bo{bo{cp|dn{dn{dn{dn{fn{fn{go|go|go|go|go|go|hp}go|eo~eo~eo~fpfp}fp}fp}gq~gqgqgqfpfpgqhoipipipgl|hm}kplqlqlqlpkojmjmknjmlplplqkplrpvrxu{v|v|qwou|}}~z{||{z}zus}x}z{x~yysxy~yw}zx}x}y~{y{|}x}x}{~u{rwuzx}w|txtxw{uyrvptszt{nyoznwktpwhohnjpai}dlhi`a|d`wfbyiaye]u`\z`\zca[YwQNnVSsXRuWQtQEjI=bTErPAn>/\=.[G8eJ;h<0^;/]E9gF:hA0]9(U@&Y>$WB&_< Y8O2I:O@%UC"VD#WC!R=LE#TG%VB$WL.a<T;SC"W:NK&ZI$XH$ZZ6lI0`L3cPAnL=jQBpQBpE2]UBmeXyeXyWSwVRvZ[YZ]bfkimlpdh^b|nnvvy|z}ű²ú˽νϿ{{zxtrpjg~lv}}z~|~~|~}{}|}}xvxyvrtsro}r}r}q|nyn|lzlzn|jyfucwfz`teyf{bwcxdy`u|`u|bw`u~`t`t`u~\qz^sz`u|cw|cw|bszaryft~ft~dr|bpzcq{cq{cp|dq}dq}bo{cp|dq}bq}bq}ap|ap|`pz`pzcqycqycqybpxbpzbpzbpzbpzbpxbpxbpxbpxaoyaoyanzanz`my^kw`jwblyblycmzanzanzanzanzanzanzbpzaoyaoyaoybo{bo{dn{dn{dn{dn{dn{dn{eo|dn{eo|eo|eo|eo|go|fn{dn{dn{eo|eo|fp}fp}eo|fp}fp}fp}dq}cp|dq}dq}fpfpfp}fp}fp}fp}gq~fp}fp}gq~iq~hp}ipiphoipjqjqkrkrntouowpxqzs|r|kuu~~~~~~~~|{|{zzyxyy}}~}~~|~~}~~~~}}~~}|{||}}{|{y|z{}{{zx|}|{yxvssvvtvtttr}nym}ofxdvj|l~hwgvjudoememai^f`hfnksiqhm`eglinemks]h^ibj^fjjddccjj`hX`|ZiXgUcYgX]Z_hjdf]]|ddffffjhpnuryvwntkwy{³°Ƚ;ɽȿ̿̾xwvsqome|i|}~}ytuool~ewhzgycr~ixj{fw~ct{ary^my`o{bt`r}[oz_s~au\p{Zox_t}^r}au^r}[oz`o{dscr~`o{fsdq}anzdq}cq{`nxgtfs]q|]q|Yoz[q|_s~`tdt~euft~ft~dsdsbtbt`u|_t{_t{_t{^s|^s|^r}]q|ZnyYmx^my`o{_nz`o{_nz_nzbo{bo{anzbo{dq}cp|bo{cp|bq}ap|ap|ap|bo{cp|cp|cp|cp|dq}dq}cp|cp|cp|eo|dn{bo{cp|cp|cp|cp|cp|fp}fp}dr|cq{cq{cq{cp|cp|cp|cp|cp|cp|cp|cp|cp|dq}dq}dq}co~dpdpeqeqeqer~er~hrhrhrismvnwoyq{r{mvt~}}}}}}||}}}}}|}}||~z~vy~yw{xotkwmuk{rulfdgehhiibbbbeehheeZZxbcXY|FKnMRuOY{MWyLVxISuGSpFRoCNnDOo9Eo6Bl9Cr3=l?Bl8;e66\CCi=?m:fIBoIBoYOxf\\PuQEjo\jWeW{tfnjkgvrplof{r~tv}tzvvtqojg|r~~~}{{yyxr~swtsxtoznylzlzlyanz_lxer~\p{ZnyZm{Zm{]n|]n|`n}^l{^kw_lx`nx`nx^ov\mtYmr^rw]oy\nx^p{\ny^qx_ry]qv\puXkr[nu]mw^nx_pwXip[mw^pz`r|bt~`szbu|_pw^ovct{arydrzft|dr|cq{es}es}es}ft~ft~ft~er~dq}cp|cp|dq}dq}dq}dq}es}es}drzcqydr|cq{cp|cp|dq}cp|co~co~dq}er~dq}dq}er~dq}co~dpdq}dq}gq~gq~gq~gq~fsfsfsfsfsfsgtfsfr_kzp|~~|{yxyyyyzzzz{{{{||{{||||{{||||}}~~~|~x|uvnob^u_[rg^z\SoXSm[VpKGc=9U3,K":)(  !!!!!!!!!!!!""""""$""#!!;/,QAP-,&$$&$$$$$$$$%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%''"11,^SL|}wv~zwxw~}xw|{{zvrusvrvqutwfi~[\w^_z`a|_`{dezmnjm}qtw|x}{wupoje|r~}}~~{wttp~o|q~kxhumzivgtivetfudrbpdsixhwcr~cr~gvhufsguft~fuds`tcw\o}Zm{_r_rZnyXlw^p{as~_nz]lx_q|btas~as~bsct`s]p~\n~_q`s`s^q^qbsarap|dsdsap|bq}bq}as~`r}^p{as~as~`r}dsdscr~dsfsfsfsfsfsfsfsfsgugueueudt~eugucq{_lxZgsfw}}{{zzzzzz{{||||||{{||||zz||{{||~¯¯¯¯¯¯®±~~xt}r|t~oyhr]gvWapU^oKTe=H[7BU5>V/8P).D',B&,9#)6%*-$), %( %("%&"%&#&'$'($'(%()&)*&)*'*+'*+'*+'*+(+,(+,),-(+,),-),-),-),-),-),-),-),-*-.*-.',-"'( 043njjǷó@02 #,#$%%%%%%%%%!!!24/cda|xtz{nygudrZiP_xTb5C`-4R-4R)-?"4"$*/+16+16,1A38HLQZinwuqjf}cwey{zzxuswuq~mzlylyoykuismwdq}anzco~frdpbn}`l{am|bpao~\jz[iybp_m|]lxdscr~`o{cr~cr~cp|fsfsfsbpzcq{btcubtdvbtewdxcwbvcwbvdxeydxeyeycwcw`t[ozZm{\o}n}}{{zzzyyzzz{{yzz{zyyyyyyyzzzzzz{{|}¯¯¯¯¯¯¯°~zx~u{rxqwntlrio|gmzekxagt]cpX^kPVcLR_OS_PT`SY`U[bX[cY\d\^h^`j]cj^dk_el`fmbhobhodfpegqgisgishjtikujlvikujlxjlximyjnzaksOYa=JP±0+-EEEVVVVUYUTXUSYOMS?=C:8>B;BD=DC:A?6=>5<>578:34.**)%%,((TPPJHH'%%SZPŸ³óò±ŲĮîë««ªt|aivGMZio|yktmvw´ĴĴƵǵȶrneyXlj{{{zzutuustuttut~t~wv~t~s}o{o{p|o{lxp|o{o{o|n{o|mzhwhwm|m|dshwo~o~q~x~~~||{{zzyyzzxyy{{zzz{z{z{{zyzzzzz{}~~¯¯¯¯¯¯¯®~yv|tzrxoulr~jp|gmzflyaiv^fsZcnU^iLU`JS^KQ]LR^RV[UY^W[`X\a[^f^aiZcg[dh\ei]fj_hl`imbhmbhmdjqdjqdirejsfktfktfktgluhmvinw[bkNU^`ho˴ VVWXXYWU[VTZTQZQNWNKTJGPJHNIGMJFLJFLJGKJGKHGKGFJHGKJIMJHNJHNLKOKJNLLMKKLKKLJJKJJKLLMJIMJIMMPQORSKONHLKJJJUUUUXP;>6$)²IJıññð¯î­­­«zjqzz|ĴĵųŴƴȴmicxbw~{{{zxx|{{{yv{}{|~|{~~~}}|{zz{{xxyyzzxxyzzz|{zzzz}}{|zzzzzz}~¯¯¯¯¯¯®®|yu}qyowmujrhp}cmzbly]jvZgsUbnN[gIVbDQ]KR[KR[RV[TX]Y[`Z\aY]b]af\bg\bg\ei]fj^gk^gkbhmcinaipbjqbjqbjqcjsdktfktglufmvhoxKW_R^fɳ!!2.VX]TV[ST\RS[LRYIOVEJSCHQFHMEGLEGLDFKHGKHGKHHIHHIJJKJJKJIMJIMKKLKKLJJJKKKLLLMMMMMMMMMMMMNNNOOOPPPRRSQQRMJNSPTb]_\WYLGCsnjлĴðððįîĮįî­­«ªpxóõŶȶȴȴ`tUi`tzw~}}|||yxyxxxyzxxyyzyyyxxzz{{yyyyyyzz}~~~z¯¯¯¯¯®¯®®~zt|pxowltiq~go|dlyckx]gt[erTamN[gGT`DQ]EP[GR]MVZPY]W[`W[`Y\d[^fZbiZbi[cj\dk]el^fm_gn`hoaipaipbircjsckremtdlsemtbou_lr;IQ]ksWZb!)UZ]QVYQT\ORZMPXKNVFHRDFPEFNEFNGEKHFLGEKGEKGEKHFLIGMJHNGINGINGIMGIMGJKHKLILMJMNIKOIKOJLPJLPLNRMOSNPTJLPGINRTY}ʲòñòĮĮĮĭïípzijdzdzdzǴɴ[o`tsxjr{~}}||||zyyyxyzzzzzzzzxxxxzzzzz{zzzz{{~~~~~z|®®zvs{pxnvksjrfn{dlyaiv\fsZdqTamMZfGT`CP\GO\HP]OU\QW^VYaWZbY[e[]gX_hZajZbi\dk]fj^gkaglbhm`ho`hobjqckrdlsckrckremt\hpO[cFT^|ϿϿŚ~v8/J1(CSR`SR`PS[NQYMOYKMWEGSCEQDDNCCMFDJFDJFDJFDJGEKGEKHFLIGMGIMGIMGIMGIMGIMGIMHJNIKOIKOIKOLLMLLMMLPONRQPTLKODAE0-1e][ƿ¼IJIJIJİůįįįĮí­ªv|õɳdzȳȳȴ`rtv[fqv~}}}zzyyxxxxxyy{||zzxyxxyy{|||||zzz{{|}~~~|}{wu{rxnwlujs~fozdlyaiv\fsZdqR^mMYhGSbCO^GO\HP]QS]SU_VYaWZbY\d[^fX`gZbi]ch^di_ej`fkaglbhmbhmcinekrdjqekrekrckremtV`hEOWr|ɱ>;E# &CFTMP^MP^OQ[MOYLNXJLVEGSCEQCDLCDLFDJECIECIFDJGEKHFLEGKFHLGIMGIMFHLGIMGIMGIMJHNKIOKJNLKOMMNLLMNNOOOPRRSLLM589598ŻñññűŰįîïİ°®­{v|ƶʳdzȳȲɳufozR`hu~}}||{zzyxxxxxyz{{{|zzzzyyyyzzzz||||||}~~|}}®~ztzrxpvntkr{hoxflydjw^fs[cpU_lOYfGQ^DN[EMZHP]LR^OUaRYbSZcV]fV]fX`gZbiZcg\ei]fj^gkaglagl`gpahqaipbjqbjqckrbls]gnHU[GTZlgi-++DK=CJ>EH>EH>FF?GGGGHFFGGFJGFJGFJIHLGINGINFHLGIMJJKJJKJIMJIMMJNNKOEEFCCD,3/KRNſ²³ŲijŲijŴƳŲİİĭíìë«ĩ§{r~{õdzdzǵȵȵȶɞgp{Qakl|nl~~{{zzzyyyxwt~t~rrstttuuvvwwyyyyyyxxyyxxxxxxxx{||}{}}}~~}zxr}nykvhs~gp{dmxbjw`hu[erXboQ^jLYeIQ^EMZEOVHRYMVZOX\QZ^S\`V_cW`dYbfZcg[dh\ei]fj^gk_hl_hlbhmbhmajnclpenrV_cTZaʲ\\\MPQNV]OW^LV]KU\MR[LQZKQXJPWHPWGOVBJQ?GNADL@CKACGBDHBDHBDHFEIGFJGFJGFJFHLFHLDILDILDIJEJKEJKEJKEJKEJKHJNJLP?BC69:AKKõïñűŰűƱűůðİİįïîí¬{z~ŴɳȳȳȳȳȀ~°²ñ°emzQ^jr|~~~}|yyxwt~t~rrsttsvvwxyyyyyxyyyyzyzzzzzzzzz{|}~®}|ywr}ozlvhrfp}cmzakx]gt[etWapS]jMWdHQ\ENYIOVKQXOUZPV[TZ_U[`W]bX^cYbfZcgZcg[dh\ei]fj`fk`fkahkbilcjmdknbhoQW^WYcƾ;=A')->FMRZaM]`M]`LY_IV\NS\LQZKQVJPUJPUIOTGJRDGOBFKAEJBDHBDHDCGDCGFEIGFJGEKGEKHFLHFLEGLEGLDILEJMEJKEJKFKLFKLGKJDHGAGF6<;^imмɸIJıűŲƲưİİİįïïĭª|ydzdzǴɳȴɴI[kPbrMbqTixXm|Xm|_qdvgujxrz}ĵŸȻʻʿ̽ʿ̻̿ȻȺǻȴųıĬ¨yakxTams~}||{zyyxxvv~v~s}s}t~t~t~uvwwwxxxyxxxxyyyz|{{{zzxxxxyz{|®~|ywqn|jwfsdq}anz_kz\hw[etV`oR\iLVcGQ^CMZGNWIPYOVYPWZSZ]U\_V^eV^eX^jY_kZbiZbi\dk]el^en^en`gp`gpbko`imY`iIPY`frì~~)+5?AKPXeT\iR]aR]aPZaLV]LT[KSZKQVJPUKOTIMRGKPEINBFKAEJ@EH?DGADEBEFCFGCFGCEICEICEIDFJCGLCGLDILDILEJMEJMGJKILMEIH;?>334KKLзðıűůƯƯŮĮ­«yu{dzdzdzȳȳȳ`sbubvau]r{\qzau_s~bq}ds_nzdsix`o{`o{cr~dq}ivivfsgukyjxkyo}qv{{Ķùƽʽʾм˽ξ̽ȸŻ˹ƲhwQ`lNaol~}||{zzyvut~t~s}s}u}u}v~v~wwxxxxyzxxxxxyyyzzyyyzxxxxxyzzz|~~®~{tozivfscp|bo{akx]gt\dqX`mT\iNVcHP]EMZGOVIQXLUYOX\PZaQ[bT]hT]hV_jXalZaj[bk]dm]dm^en_fo`gpahq`jq^hoLV]eov\Y[#JHNWXf[\j[_dY]bU[bPV]OU\MSZJPUJPUKOTIMRHJOGINDFKBDIBDIBDIBEFCFGBEFDGHDFJDFJDFJDFJEGKEGKDIJEJKCKKCKKCMMBLLALJ3>LcVd{u~}~}}|zywv~v~u}u|t{u}v~ttttwwxxyyvvvvyyyy{{yzzzzzzzzz{{{|~®}{ztp~kyft~dr|`nx_iv\fsZdqWanT\iNVcHP]EMZHOXJQZMVZOX\RZaS[bS]dV`gWaiXbjZaj[bk]el^fm`ho`hoaipbjqYcjPZaPY]Ǹ25=BEMYcpXboUehTdgXcgT_cS\`NW[LT[KSZKQVHNSHLQEINGIMGIMEJMBGJ@EH?DG@DI@DICEJBDIFDJFDJGFJHGKEHIFIJDIJEJKEJKFKLFOM7@>3==DNNƼ°ñIJŲ²³óññð°°įïî­­¬zy}ǷɳųŶȶȵȶbu|dw~cxcxcxcxcxdygyhzlzlzm{m{mzn{o}p~qrrsuvxy|~|Ved' #&#(+++,""#//*wwr²IJijŲIJĴƳųŴƵǴôôƳųƴǵȴdzƵȵŵųŰ³ôijó÷ôµŵŲƳdzȲǶ˴ɶɵȴdzƵǵǵǵǷǹɹɷǸȺʽϺɵųïlwr}}|||{yxwv~u}u}r|q{r|s}s}t~t~t~t~uxwvwwwwxxxxyxxxwxxxwwxxxxyy{{{~~~{zvs~lzgucq{`nx^kwZgsXeqTamP]iGT`GQYFPXGOVJRYMVZOX\R[_S\`S]dWahXbiXbiXbiYcj]el^fm_gn`hoahqcjsU\eW^gw~ŨwtvKOTein^it\grYfjWdhWbfT_cPZbKU]LS\JQZHQUFOSCLPAJNEJMEJMEJMCHKCEIBDHBDHCEIFEIFEIFDJHFLEGKEGKCHKDILEJMEJMEINEINCJM6=@;FDfqoĸ¯¯¯°òųóóóññîĮĭîĬ¬®­}y|ôñóŵʴɳȳbu|cv}dw~dw~eugwgwfvhxhxkylzlzlzlzm{m{n|n|o}t}u~tuwy|}~oww25-  rvu°ǯƱȳȳȳǵɹ˽Ͼεŷ¹ĽɿǿοʽʻȸŶöĴµĸǵƱ¯~}{zzz{xxv~v~v~u}t|s{s{t|t|u}u}u}v~v~x~x~wxwwwxxyyywxxxxxwwzyyzzz{|~®®®~|ywtq~jyetbp^l{\jyXfuVdsR`oN]iET`EP[CNYJPWKQXOVYQX[T[^V]`V_cYbfZcgZcg[dh\ei]fj^gk_hl`imbjq^fmHRZ_iqüIHLR\deow`nx[isYhnUdjUaiR^fOWdKS`IQ^HP]HPWGOVDLSAIPDILEJMFKLDIJAHK>EHBDICEJFDJGEKGFJHGKEGKEGKEGKGIMGIMGIMFKNAFI7@C/8;MY[ξ­¯ïðıŲƲƱűűŮŮŮŭĭì«}zxz·ƳųŴɴɵȵdt~dt~cucuavbwcwbvcwcwfxgyiyjzjzjzjzjzmzlyn{p}qrstuvxy}~896222222317!&jt *7    #&'hkl|{zzywvuv~v~s}s}p}o|o|p}p}p}r|r|u|v}v}v}w~xvwwxwxyzwxxxwwyzyyyzxxyy||}~}~~~|{yvr|lyhucp|`my]ix[gvXdsUapQ_iJXbCQYAOWGOVJRYMVZPY]S\`T]aS]dU_fVciVciWdhYfj^gk^gk`hoaip`gpW^gJP\u{Ǻigm?=Cbltfpxbos_lp\imXeiXbiU_fQZeKT_IR]HQ\HOXFMVDLSAIPAGNBHOCKKCKKCHIAFG@EHAFIAFIBGJCHIDIJCHIDIJDILDILEINEINEJM?DG=BEEJMox{Ⱥ³íîİƱűűűŮŮŮŮŭĬë«­«~xu|ƹʴȳǴɳȳȳft~ft~dt~dt~bt~cubwbwbwcxfyfyizhyhyizkylzlzlzm{n|q|q|s~tuvxz}z794 311311413!!"~~V]f #"_cb{|{{zywvuv~u}s}r|o|o|o|p}o|p}p|q}t~t~v}v}v}w~w~xyywyyyyyyyyyzzzzzzzz|}}~}~|~|xu}nxjtdq}`my_lx[htXeqTamO\hHUaCP\ANZHPWKSZMVZOX\R[_S\`S]dV`gVciWdjZei[fj^gk_hlbhmbhm\ajTYbgiuƺYZbRS[goviqxeptbmq]jpZgmWckT`hQZeNWbJS^HQ\HNZFLXDHTBFRDEMEFNGJKGJKEJMBGJAFIAFIBGJBGJEHIFIJFIJEHIDILEJMEJMFKNCHK@EH=DGkruƷîİıűƱƱưŮŮŮŮŭì­~ut~ŵǵdzȳȳȴdq}er~ft~ft~dt~dt~cucucuewexfyhygxgxhykylzlzlzlzm{m{n|q|s~ttxz{|s}}383  2001//302 !{{|++,' "6/19-00..uss{zzzxwxv~t~r|p}o|n{n{o|o|o|p}p}q~rrt~t~wwv~xyyyzzzzzyywwwwyyyy|||}{|}~~~~®}|uq~lyhudq}`my`jw\fsYcrV`oO\hIVbDQ]ANZHOXJQZMU\OW^QY`S[bS]dV`gWbfXcgYdh[fj^gk_hl`imbkoY^gJOXŻb_hPQ_eftjryhpweovdnu^kq[hnVdlTbjP^hKYcIT_FQ\HNZFLXCHQAFOCDLDEMGJKHKLEJMBGJAEJAEJCEICEICEIEGKHGKHGKFHLFHLCKKCKK6@@4>>AJM͸¯ðĭįƯƯƮůưİĮĭí쫪}uyĵƵǵǵǵǶȷcr~cr~cr~cr~dsdsbtcuaubvdydydydycxdyfxgyhzhzhzi{k{k{n|o}qrrsvxz|ox|154 000///0/3 #{z~JMN22241:++5llv|{yxxwt~s}q{pzoypzn{o|p}p}r|r|s}t~t~t~r~r~ssuuuuwxxxyywwwvxxyy|{zz{{z{|||}~~¬|yu}pxksgo|emzbjw^fs[cpX`mQ\gLWbFQ\DOZFPXIS[MU\PX_RZaS[bU_fV`gXbiXbiYdhZei]fj_hlajn]fjNW[YbfTRX]_koq}jswhqufosfosakr^ho[elXbiU_fPZaKU\HRYGOVFNUAIP?GN?EJ?EJEINEINEINDHMCEJCEJCEICEICFGDGHEGKEGKEGLGINEINEIN.:<5AC^hhĸ¬íĭĮįůůůůűñï¯ðĭ}vw{´óųųdzǴȵas~btbtbtbtbtdsdsdsfudvdvewewexfyfygzizizj{j{m{m{m{n|o}p~r~ttv{|~jrr/40 ////////0"wvzbgh /32027#$&0\^hw}|}||{yyv~v~t~r|p}n{mzn{n{n{q{r|q{r|u}u}t~t~s}t~rsttvwwxzyxyyxxxxxyyyzyzz{|}{||}}~­­~zxxurzjrgo|dlyaiv^fsWdpTamN[gHUaDQ]ANZIQXJRYMU\OW^S\`U^bV_cXaeZcgZcg[dh]fj^fm_gn`hoS[bZcgxžhclooyuuntyntyluygptcmt_ipZfnVbjS^iNYdIS`FP]DOZBMX@JR=GODI=CHDFKGINIKPHJOFHMDFKCEIDFJFEIGFJGFJHGKHHIJJK?GG-55;LM~˾ĴîĮİıűűŰİİıŰİįî­|w{}ȶȱòĵǵǵȵ`u~`u~`u~`u~bt~bt~bt~bt~dt~dt~fveudvdvdvdvdvdvexfygzgzgyhzhzhzjzk{l|m}n~ortxz}~|xz\ec-.+..///0,/0"pux|{^ge-40/16)+0&HHRvy}|{zyyxv~u}u}q|q|pzoyoyoyoyq{q{q{p}q~q~rrrrrstttuuutwwwxxxxxxywwvxxxxyz{{}~~¬®¯®|zxu}ksfp}bly_iv\fsWdpTamO\hGT`DR\BPZFPWISZMU\PX_S\`T]aW`dYbfZcg\ei\ei]fj_gn\dk^fmU]dFDJ!#()+0',/%*-%+*/54QWVmsrpuxdil\dqX`mT\iOWdKS`HP]EOVCMTAIP>FM=CJ=CJAEJDHMGKPHLQGINDFKCEJCEJCEICEIGFJGFJEHI?BC8A?Hsvz}x}||yxwvvt~s}r|pzpzoynxmylxmymymynzo|p}p}q~s}s}v~v~x~x~x~x~wwwwxxvwwwwwuuuuuvwwwxyyz{~~~~~~¯~zxs}lver~anz_iv\fsYcpV`mQ\gJU`DPXCOWGQYJT\LV^OYaQ[cT^fV`gXbiZaj[bk\bn]co`frY_k]bkwtx---112''(!  CGFhmnejk`gp]dmXbjQ[cLV^GQYGNWCJSCHQ@EN@BL@BLADLBEMEINIMRHLQEINCGLBFK@GJAHKCHIBGH<@E/38AIVmu̿òİŰűƱűŰıŰİĭí쬫«¬|v|}ĵƱDZDzɲɱȱbu|at{bu|bu|dt~dt~dt~dt~dt~fvdvdvdw~dw~cxbw~cxbw~cxdyhxiyjzjzjzjzjzjzm{m{m|m|o}qrtz{}~}}~}||}||{vvr|r|t||>FF).)../../*-. %(sx{xu|wz|}}~~w~szx`cd!"-.+.-1+*.;8Atuyzt{{~~}zyxwxwwv~u}s{pzoyoynxnxoymzmzmzn{n{o|p}p}t|t|u}v~x~x~x~ywv~uuuvvvvvxxvwwwwxvvwxxy{|}}~~~~~~~®}zyt~nxfp}akx^hw\fuWcrT`oN[gHUaEP[CNYHRZJT\NU^RYbT\cV^eYahZbi[cj\dk]el_gn`gpZajejs__`051ION`fejnmhlkbjjT\\9?DKQV^gkbko^ho^hoYckS]eNWbJS^GNWDKTCINAGLADL@CKBFKCGLGINJLQIMRHLQCINAGL@FKAGLDIJ=BC9?D7=B]erɷǶIJŲųƱűűűŰįïðĭíë{w{}´űııűųȳdt~cs}dt~dt~ev}du|dt~dt~dsetexexexdw~cxcxdydydydyhyizjzjzlzlzjzk{k{k{l|k{n{p}qrvy{|~}||||||zzzzyyyyzzt~s}pzku}muu7??).)../../+./!++t~~u}rzwy|}~~~~}{tzousyZ_`#$#-4*,/0(+,56>nqqtrxx~{~~}}|{zyxwx~x~t|rzpzoyoynxlymzmzmzmzmzn{n{o|o|r|q{r|s}v~v~v~v~t~t~ut~uuuuuvuvvvvvuwwwxyzz{{|}~­­­­¯¯­¬¬­­­®­¬{xwt~nxhrakx\hwZfuWcrT`oMZfGT`EO\CMZJQZLS\OW^RZaT\cV^eX`gZbi[cj[cj]el^fm`en^clwyVUYBKNenqoyyr||{s|enr^en_fo`gp`gpYbmT]hOYfIS`DPX?KSAJN@IMAEJAEJDFKEGLFHLIKOKMQKMQDJOCINAGNBHOCIN:@E3@D=JN{űïİűŰıŰıűŰŰůįĭĭī«©|u~{~IJűűųųųdzat{at{bu|bu|bu|bu|btbtbtdvdw~dw~dw~dw~fyfyexfyhygxiyjzjzjzjzk{k{k{kzl{l{kzo|p}q~ruwx{|}|zyyxxwxwvwwwwvttsutp{nyoylv~fpp1;; %.*).1(-0).1#,0xr~nzq|tuvz|~~}~~~}}|||~~}|{zvt~s}kunwu~W]\ $'/2**,0&(,25=kq~mspvu{x~y|~|}~~}|{yx~wu}q{pzoyoymzlylymzlylylymzmynzn{o|o|o|p}p}rrt~t~t~t~t~t~t~t~t~uuuvuuut~uwxvwxxwxxyz{{||||}}}~}~~~¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯­¬­­®î­­¬|xt~oyhrcmz_iv\fsXboU_lOYfHR_FN[FN[HRZKU]NV]RZaT\cU]dY`iZaj[bk\cl]el[cjYbfox|xylmury~}y{{yxvow~fnubir`gp\dkW_fSZcNU^HQUCLPCJMBIL@GJ?FI?EJ@FKEGLHJONLRPNTNLRJHNIGMJHNFJOAEJDMQU^b­­­¯İİIJIJIJijűűŰİįįĭī­Ĭé{s{z{}ȴȰıűűųǴcs}cs}dt~dt~bt~bt~bt~bt~dt~euev}fw~fw~fw~fw}gx~gxgxgwhxjxlzlzlzlzlzjykzkzl{l{l{o|q~rstxy{|}~{zyxxwvvvuuvuuwuuutr~nymxiu}jv~^hh((!'0,).1(-0#(++8GKDI@FKHHIJJKMMNTTUPOSMLPHJNGIM?CH?CHT]a¯ïðIJ²³³³óðİĮŭĬꫨ{s|{}ƳűıIJƱųȳdr|dr|es}dr|cs}dt~cs}cs}dt~dt~du|du|ev}ev}ev}fw~hv~hv~iwjxjxkykylzlzlzm{m{mzn{kzl{k}mnosvyz}~~~{yxwwvuvuuuuvvvuttp~m{kyhvgs{iu}[db$*/**,0+-1 $)BOUwnj{m|pttvxzz{|~}~~~|{zyxzz{{|{xxxwvuut~t~t~s}oymwgq~js~qzOTW!%$*.-',/"'*":@Ggn~lshrlvqyt|w}x~x~z{|}~~~}{zzv~u}q{oymzlylylylxlxlxlxnxnxoyoyoyoyq{q{pzr|r}s~s~s~t~t~t~t~v~v~t~t~t~t~t~t~t~t~v~v~v~wwxxywxyz{{{|zzzz~}}~~~¯¯¯¯¯¯¯®ïį¯¯¯¯®®xvrmzdv^p{]lxYhtWdpTamN[gHUaEO\DN[HRYKU\PX_RZaT\cV^eYahZbi\ei]fj^gk[dhhqutztzpxlt{`gp`gpbkngpstzy{}v|tzht|bnv\grValRZgLTaIO[DJVCKRAIP>FM=EL?EL@FMEHIFIJLLLQQQPPQNNOHJNACG.7;GPTt{~ñòIJijųųųŲıŰİůĬ뫪{r{xz}~ŷǵĵĸʵǵǶ_nz`o{ap|ap|ap|ap|cp|cp|dq}er~ft~ft~dt~dt~dt~euev}fw~hviwiwjxkylzlzlzlzlzlymzn{n{j|k}klruxzz{|}zxvuuttutrqqrsrrrqn|lzivfsdozep{U[Z###---)+/)+/(IS`un|kylzn|r}tt~vxyxy{{{{||}}~~{zxxxyxxxxxwvutsrts~r|q{q{mwisgqjrpxKMR',-(-.#,0'+$8BJhrhrhrkupxrzs{u}s}t~t~vyz{|~~~}|{zyx~v|rzrzmzlylylylxlxlxlxlxlxlymzoyoypzpzpzpzq{r|r|r|r|r|r|s}u}v~u}t|s}s}t~t~t~t~t~t~t~uuvwxvwvwxxxxxxyz{z{{|||}}}¯¯¯¯°ððððﯯ¯¯¯¯¯įĭ­­¬­­­¬­¬xvrn|hv`nx^kw\iuXeqS`lOYfIS`FN[FN[HQ\KT_MVaQZeS]eT^fXbiXbi\dk^fm[cjckrzz~rxntemzX`m?HS6?J.881;;AH>bi_|v{||pzisz^hoYcjR[fNWbIO[FLXCJSAHQ>DPCF9>A.7:\eh®®¯ïİŰűƱƱưŰŲűİůĮîëªzoyw{~~Ƕȳųųȳȳȳ_mw`nx`nvaowaowaow`nxaoycnydozdozgr}es{ft|ft|ft|ft|ft|iths~julwkylzlzlzlylylymzm{n|l|n~optuz{|}{{yxvuttsrsrrrrrrqqo}lzkygtcp|_mu_muIPS #")-,(-0(-0#!+OYft~lzjxnzp|t}u~u~wwyzzz{{{||~~~}{yxxxxxzywwuutst~t~t~r|q{pzoykuhreo|lrtzDCG),-*-.$-1#'@FRjqpwktnwpyqzr{s|t}t}u~vxy|}~~}||zyyxwv~t|r|pzmzlylylykwlxnxnxnxnxnxnxqyqyqyqyqyqyq{q{q{q{r|r|r|r|u}u}t|t|t|u}r|t~t~t~t~t~t~t~wv~v~wwxyzzzz{{|z{z|zz{{|}¯¯¯¯¯°ðîîîîí­­ĭĮîîí­­­­¬¯¯­­­­­­­­¬{wpl{gvap|^l{YgvUdpRamMZfGT`CP\BO[IR]KT_OYaQ[cS]dU_fWahXbiXei[hlK[^euxwy~mt}ipyZfnO[cCLOJSVIPSBIL&/2:CFglgzz{rv{ekr^dkV\hPVbJS^ENYBKV?HS?FO=DM>DK@FMEGKEGKJJKMMNLQRJOP6?B5>A8@@|ñűŰIJųƳƲŲŲŰŰŰůĬìëª}uv{~}ȯűųdzȳȱȱ[jv\kw\kw\kw]lx]lx_lx_lx`myanzbo{cp|cq{dr|dr|dr|es}ft~es}ft~hvjxizj{j{j{lylymzlymzmzmzn{p}rsuxz{|{{yxuttsrrpppppponm}k{kyhvfsanzdnvcmuCJM  $)(,1).1$),/4=V`ms}kykylzm{o|p}rsuvvxyyyyzz{|}~|zywvuwwwwwvvwtsrrq~p}q{pzlygtfp}cmzkn|ru/.2------',/!#,MR[jqryiu}mynyozozp{pzq{r|t~t~uvxyz{}~}|xxw~v}t~s}o|n{lylynxnxnxnxnwnwmwmwnxnxnxnxoyoyoyoyn{o|o|o|o|o|o|o|p}p}r|q{q{r|p}p}q~rrrt~t~t~t~v~wwwwxyyxywwxxxyyzyz{||}}}~~¯°ï¯¯°ñıİñİðððððñİﯯ¯®®­­­­­­­­¬~{xrn|ivcp|`jw]gtZdqV`mN[gGT`EO\EO\IS[LV^OY`Q[bQ^dS`fWaiXbjZdkXbi\fmy~}yx|jns^bgJNSHLQV\[~`frCIU?ED^dc{}x|tyzdnu^hoR]hOZeIV\DQWDMQAJNAGL>DI>DI?EJCGLCGLDHMGKPLQTNSV:?B=BEV[^ïðİİŲDzǰűưŰŰŰůİðﯭzr~z}˳DzƳdzȳȳȳZhp[iq\iu[ht]jv\iu\iu]jvakxakxbmxcny`nxbpzbpzbpzcqydrzcqydrzgu}jxkzl{lzlzlylymzlylzlzlzn|o|q~suxz{{{{xwuttsrrrqqqqp~o}n|m{lzgu}drzdozalwdmxXal?DG&&&,,,,+/$#'=?I]erqyjxjxl{l{m{o}qrsuwxzz{{yy{{~|yxvuuuuwwwvttsrrq~p}n{oynxkxhufp}blylr~lr~"%&...---)+/ $0SWclsnujw}mzmynznynyoypzq{r|t|v~xzyz{|~|{yxxv~u|t{q{oylxlxnxnxmwnxpwovovovovpwpxpxpxpxpxqypzoyoyoypzpzn{o|o|n{pzpzq{q{q{r|r|s}u}u}u}u}v}v}v~v~vvwwxxxzxyxxxxzzz{|}}~~~~~~~°ðððñııııııİðððððððï°ï¯¯¯­­­­­­¯®í®¯¯¯­ĭĭĭĭĭĭ¬¯®}xq~n{lxam|^jy[gvYetT`oLZiDRaDQ]CP\KU\LV]PY\S\_T_cWbfXcgZeiZbiZbiv|yx|uw{wy}ginTV[ACHJLQ`bffjoX\aKQVJPU^ba~~y|}jryaipSaiM[cHV`BPZANT>KQAGN?ELACHBDIDFKFHMGIMGIMMQPGKJ&)*CFGzx~IJIJijųŲIJŲŲŲŲıððí­«ytx{ʶŴĵŵȵȵȵ[em]go]fq^gr\gr\gr\hp\hp]iq^jrajuclwalwbmx`nvaowaowaowbpzbpzfshujxkylzlzjyjyk{jzlzlzlzm{n|qrtxy{{{zxvttsrrqqqqqn~m}l|jzkyhvhs~dozbly_ivdmxLU`7:;(((,,,,,-##$ CFNckxnvhv~iwjxkynyp{r}trsuwzz||{{z{|}~~{xwtttttttsssssrq~p}q{oypxnvkripfm}dk{lrbhu"%--.,,-,+/$&2\^jovjqktmvnwoxnxnxoyoyq{r|t|v~wxxzz|~}}|yywv~u}s{pznxlylykxkxlvmwmwmwkwkwmwnxnxnxpxpxqyqyqypxpxpxoyoyn{n{n{o|pzpzpzq{q{q{q{r|t|t|t|u}u}u}t~t~t~t~t~t~v~v~wywwxxxyz{|||~~~~}~~~~~~¯¯¯®ïĮïİŰŲűııİðððñññï®ë««¬ë«««­­­­¬¯¯¯¯¯¯­ĭĭ­¬®}zr~p|jx_m|^jy[gvXdsT`oLZiFTcER^CP\LUYMVZQZ]S\_V_bXadXcg[fjZcg[dhwu{pu~ty\_g@CKC@IYV_hfl}sw|cin\bg]_dGIN?CBuyx~ntyflqVdlP^fGVb@O[BMX>ITAFO?DM@DIBFKCGLEINDILCHKPSTNQRB;=hacĻ±òŲŲIJIJIJİűưůįİůįĬë©ttxy~ǯųdzǵȵȳȳV`mWanXboYcpWdpWdpXeqWdpXfpYgqZgsZgs[gv^jy]lx^my^nx^nx_nz`o{dq}fsivkxjyjyhzhzhzhzjzjzjzk{mzp}rsvyz{|yxvtrrrqp~p~p~qp~l~j|hzfxhves}dn{akx`huaivlryKQX---+++,,,,,-!!" KNVpxnvguiwjxkylymzo|q~rrtuwxxxxxz|}~zxwuttttstt~t~t~t~rp}o|n{pznxnxisjqfm~dk{dk{hnzZ`l *-.),-(-0$)2afoqxjqgtivjwkxlylylyn{n{o|p}p}t~uwyz{~~}|{{yx~u}s{pzoykxkxjwjwkwkwkwlxkwkwkwlxlxkwlxlxnxnxnxnxpxpxpxqyoyoyoyoyoyoypzpzpypypzq{q{r|q{r|p}p}p|p|q~rq~rrrt~uttttvwxxxyzzz{z{z{||}}}~~~~¯°ñİñııIJŲŲűıIJŲŰðñıIJűį¯¯®îîîí­­­¯¯­­­¬¯¯¯įį¯®~zsq~lycp|biy^eu\csX_oN[gHUaFQ\FQ\LT[NV]RX]U[`V_cXae[cj]eldjqmszytzOXc)2=.;AP]c^jlamoGOV08?KNVMPXTQZVS\SVWlopy}|rtxlnr_gnX`gNX_HRYELUBIRAGN>DK>DI@FKDHMEIN4>K:DQRWZ_dgdhghlkv{~}ns|inw^fsV^kLYeER^CMZ>HU?EQ>DPADLBEMDHMEIN>@E%',889nno¿®®ïIJųƲijųųŲŲŰŰůįįĮí­©t~r|xz~ʳŴƵǵǵdzȳQ\gS^iS]jT^kU_lV`mTamTamTblUcmVcoWdpXdsZfuZgs\iu]ku_mwblyblycmzeo|fsivhxiygyhzhzhzgyhzjykzl{m|rsvxyzzywvsrrqp~o}o|o|p}o|k{iydvbt~bq}_nz`jy^hw^fs`hufos/8<)-,++,,,-),-"#Zcgt|hp}ft|hv~iwjxlzm{n|o}p}p}rsstuuwwzz}~~zxutstsssrsrts~r|pzoyoynxlvhreo~cm|bl{akzbl{^fsHP]"*,0*,0(-. '.1lsvpxhp}hrjtjwkxlylylylylyn{q{pzr|t~v~xy|}~}{zyx~w}t{szn{mzlyjwjwjwjwjwjwjwkwkwiwhvhvjxlxlxlxlxlxlxlxkwnxnxnxnxoyoyoyoyoyoyoypzn{o|n{n{n{o|o|p}p}p}p}p}r|r|s}s}s}t~rrr~r~t~uvvtuuwyyz{yyzz}~~­®îïįį°ðñIJŲųƲŲűIJŲŲŲŲŲŲŲŲűııİñıİðððŰůįį¯¯¯¯¯¯¯¯¯¯¯¯¯¯įįĮî®~{uo~myfrakz\fu]duX_pQXiLSdEMZGO\LR^OUaQ[cR\dT^fV`h\cl`gprr|||~}}|{z~KJN8=@y~yxakxDN[=GT^hutkwKZf!0<(.,2GJ   .3/mrnt}{rzrznthnz`huZboS[hIQ^EMZBJWAGS>DPBEMCFNIKPNPUcbfxw{tswwvz««¬­ðıűƱƱŲƱűŰİİůİï­¬xvz|űôǵȵȵȵȵQZeR[fRZgT\iS]jS]jR_kR_kQ^jR_kTbjTbjValXcnZep[fq]gt_iv_iv`jwblycmzfq|hs~jxjxhxhxhxiyixixixjylyn{p~sxxyyxxvtrrrq~o|o|n{o|o|lykxhufsdq}cmzakx^hw\fu^fsbjwY_d#(,+(*/)+0#$,17Djp}gtdq}ft|gu}hv~hv~jxlzlymzn{o|q~rsttuvwww|~~~|ywutrrrrsrrq~q~p}pzoynxnxjwer~bo{`mybiyahxcivjp}agl'-2###///,+/,+/'+01>Bq~euaq{er~fsiskulvmwnxnxnxoynxpzs{u}v~v~y{|~}}||ywxvt~s}p|nzmylxkxkxjwjwkulvlvlviujvjvjvjvjvmwlvlvmwkvlwkwkwlylynxnxnxnxnxnxoyoymzmzn{mzn{mznznzo|o|o|o|o|o|p}p}p}o|p}q~rrr~r~r~r~rst~uuuwxyzxyzzz{|}įį¯°ððŰųƲŲŲŲŲŲŲűİñııIJűııİðŰŰűưŰŰůįįį¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯®®ë«~}|smzfs`l{]ixZexT_rNZiGSbER^ER^LW[OZ^R]aT_cYbfZcg^gkdmqnrwptyvuyyx|nowOU\sy}xfpxIT_NYdksz~OUZ#(#/Y_kx|qypzq{nwjs~bly[erR_kHUaEQ`@L[AFV@EUCEOEGQLKOJIMohi¬«°ıƱƲDzDzDZƱưŰůĮîëªsp~xz}ŶŲǵȳȳȳȳMZfMZfN[gO\hN^hN^hN]iO^jP]iR_kTblTblTamUbnVcoXeqZgs[ht\iu]jv^kw`mybo{fsgwhxhxhxhwixixjyixjyjykzn}qwxxyxxutpppoo}o}o|o|n|lzkygufscp|anz^kw[gvYetZgsWdpNUX  (,+'+0&*/&#*ANZdq}bo{er~ft~gueueugvhwjykzk}l~mnnoppttuuxy{|}xwussrrrrrrrq~o|n{lylylyivdq}bn}_kz`jy_ix`hujr[_d$%$(,+/)+0)+0!%*DQWq~as}`r|btbthuivjwkxkxlykxlymzmzo{p|rsuvxy~}|xwusrq~p|nzlxlxmwlvlvlvmwmwlvlvkxjwjvjvkwjvjvjvjvkwmvmvmwmwnxnxnxnxlxlxlxlxmzmzmzmzmzmzmzn{n{o|n{o|o|o|p}o|o|p}p}o|o|q~p}q~q}q}q}r~rrssssttuvvwwxxxyz|}~~~~­¯°ðñııIJųƳƳƳƲŲŲűıIJŲűIJŲűıııııƱƱƱƱİñį¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯®~}tnzfr`k|]hyYduT_pOYfIS`HP]IQ^KU]OYaQ[bT^eV`gXbi_hlajnimrjnsmqvptylt{bjqY_fhnu|}qyJRYHHRݬnqpypynxjt|dn{]gtTamJWcFRaAM\AGT@FSFGOGHPLKO;:>><HHT^^±űųƲŲŲŲŲŲŲůĮí­©~smzx{~ɵɳdzǴɳȳȴJ[bK\cK\cK\cK[eL\fP^hO]gO]eQ_gR`hSaiSaiTbjTbjTbjZbo]er^fs_gt`jwblybmxdozft|hv~ix~jyhyhygzgzh{h{jzk{o}rtxyyxwurrp~p}o|o|n{n|o}m{lziwft~drzcqy`my\iuZfuXdsenyXal176(/+&-)#).$*/ '-2antjw}anzbo{dq}er~fshugvhwjzjzi{i{j|k}mnrrstuvxxy{}}~}{xvurrrrrrrrq~p}o|mzlylykxfsbo{bl{`jy_ix_ix]gtdn{>EH &&&,,,)+/*,0#*,8S[omubszbszes{ft|gthuhuivivjwkxlylylymzo|p~qtv{}~}|ywvut~s}r|pzlylylykxjwkxlvlvlvlvlvlvkukukulvkukujvkwkwkwlvmwmwmwmwmwmwmwmwmwnxnxnxoyoyoynxoyoypzpzpzpzpzpzpzq{q{q{q{o{o{o|p}p}p}p}p}q~q~t~t~t~t~t~uuvtuuvyzzzzz{}}}~¯¯¯°ñIJŲűijƳƳƳƳƳƳƳƳƲŰŰŰŰŰůįįıƱưűƯƯƯįĮîîîîîí­­­¯¯¯¯¯¯¯įį®¯¬~zwp|jvdp^jyZevU`qOZkFQbER^FS_JW]N[aP]cR_eUbhVciZbiZbibfkgkpirvluygv|fu{dr|Ucm`imy{wovy;BE+,)PQNjkyouv|q{pzkwht|fq|alwZhrM[eHUaBO[@HU?GTCHQDIRBHMGMR\bgv|±ð°ıűƱƮůƮŭĭíîîí¬unyz|ųŴƵǶȶȳȴLZdLZdKYcKYcMZfN[gM[cN\dO]gP^hQ^jQ^jS`lS`lS`lTamUbnWdpYfrZgs\hw^jy`myanzbq}dsdsgvgwhxiyiyiyjzjyjyo|q~wzz{xwtqp~p~p}n{n{n{n|n|oznyiths~frzeqybmx_ju\fsZdqfosS\`$)$"(,+'+*&*/'+0 35?ksgo|aoycq{er~fsetfugvgvixixjykzl{m|o~pqqsttuwxzz{|~}xvtrrrrrrqq~q~p}n{mzlylyivfsbo{akx`jw_ix^hwemzaiv5DKnuelaoydr|ft|ft|du|ev}fufujwkxlzm{m{o}p~rrrsssuyz{{~~~~~~~~|yxtsrrrt~s}q~q~rq~o|n{lykxkyiwer~anz_lx^kw_ix^hweo|U_l.7: $)*',-)+/ "&KMY^eujqdozdozfq|hs~hrjtjtlvlwlwkxkxlylym{n|q|r}v~v~x{~~~zzzxv~u}q{oynxmwlvlviuiujwjwjwjwjwivivjwjvjvjwjwjwjwjwjwkxkxkxjwkxjwkxkxlylylylylylylylylylylymzm{n|pzpzmzn{n{o|p}o|o|o|p}o|o|p}q~p}p}q~rrrq~t~t~v~v~uuvwxxwwxxxzzz||~~¯°ððñıııIJųƳƴdzƲųƳƳƳƳưűƱưŰůİŰŰŰŰǰǰǯƮîðï°ï­­­­­­¯¯¯¯¯¯¯¯¯¯¬~yvpi{dv^p{WgwQaqLZjFTdHR_HR_OW^QY`S^bU`dXcgXcgZcg^gkclohqtjuyjuyht|iu}gu}ft|is{cmuY[_kmqq~q~rp}q{q{pzpzmzkx~iv|erx`jwT^kMTeHO`CHX@EUDJQFLSKPQlqr¬®ĮıűűƱƱưŰůįïî­­xu}ȶȵǵǴɳȳȳNVcNVcNVcOWdNYdOZeO[cO[cOZeOZePZgQ[hP]iP]iP^hQ_iR`hTbjUcmWeo[fq\gr^it_jualwdozes}gufw}gx~hygx~fxgyfxgyl|puwxyxwrqono}n|m{n|n|m{lzkygues}dq}cp|alw]hs[er[erekp8>C%'"******&,+ %$MZYlwbmbpzes}es{ft|dt~eudvewewgylylym{n|p~qs~tttv~xxyzz}|}~~~~{xurprrtts}t~s}r|q{oynxmwjwgtcp|`my`jy_ix_ivakxfpxJT\+33(,+)-,--.  UTajohm}blydn{fp}hrisjtjtjtjtkuivkxlylylyn{n{p}u}v~w~z~~}zyywv~u}s{qylykxjwjwiviviviviuiujwjwjwjwjwivjwjwjvjvlvmwjvjvkxkxkxjwkxkxlylylykxkxlylxlxlylylymzmzmzmzmzkzl{m|m|m|m|o|o|p}p}p}p}o|p}p}q~q~q~s}r|s}t~v~v~wxxywwvwwxxyyzy{z|}}~~~¯¯¯°ñıIJŲŲŲųƳƳƳƳƳƳƲųƲŲűııIJŲŲŲŲŲŰůįĮîîððððí­­­­­­­¯¯¯¯¯¯¯¯®~{xsl{hwap|ZhwTbqM[jGUdHR_IS`PX_S[bT]aW`dXaeZcg[dg`ildprjvxgwzgwzgu}gu}hv~gu}ft~`nx!&TVQtvqu~py|luypy}s{rzryryp{ny}jv~gs{`myVcoQXhGN^GHVDESGJRLOWS]]y¬­î®°±ñűŰİIJųƲűııİﯯ¬xv|~·ʴǵȵȶɶɵȵKUbKUbMXcMXcMYaNZbMYaMYaPYdQZeQYfRZgO\hO\hP]iP]iQ_iR`jValValXcn[fq\hp^jr`ltbnvcqyes{gu}iwexexfxfxgyhzm{quxxyxwsrom}n|n|n|n|n|n|lzjxft~dr|dr|bpz^ltZhpZdqZdqW]d17>"'#&*)&*)#,(#45Rcdiw`n~bpzdr|drzft|du|du|dvdvhxiylylym{n|o}o}r|s}t~t~tutvxxz{|{}}~~~{wusrttttrqrp}pznxnxmwjxft~bo{_lx^kw\iu^hublyov>EN !,,-,,-,+/ ^^hnsfk{`mybo{dq}fshvhvhvhvhuivjwkxkxlylymzn{o|s}t~uw|~~~{yyxvu~pznxlykxjwjwjwiviuiujvjvjwjwjwjwjwivjwjwkxjwkxjwkulvkxkxkxjwkxlylylykxkxlylylxlxlxlxlylymzmzmzn{n{n{n{n{o|n{o|o|p}p}p}p}p}p}p}p}p}o|o|p}s}s}s}t~t~uuvuuvxwwxxyyyzzz{|}}~~~®îﯰðñıijȲdzƳƳƴǴǴDZƱƱƱưŰŲŲűıIJŲŲŲŲŲŲűıııİððððï°îí­­­­­­¯¯­­­­­¬~{yql~fx`r}ZgsWdpO\hIVbJS^KT_OZ^Q\`V_bXadYbeYbe_ejcinhswlw{gwzgwzgv|gv|gu}gu}judoz *+(222555555333-10.21BLFhrls~o|zpzpzpzoylyhu{cny\grS[hHP]CFT>AODIRRW`bkn¯ð°°İıŰİİıűűƱưůįĭ­­«|vvz}ǶƵǵǵȵȵȵLV^NX`NX_OY`PX_QY`PW`QXaQWcRXdQZeQZeOZeP[fQ]eQ]eT^fT^fU^iW`kXbj[em^ho_ipalpcnrdnuhryht|ht|gu}iwhyhyhwjylyq~wyyxxvrpn}m|l|l|n|n|l|l|jzhxdt~br|cq{aoy^lvZhrWdp[htNS\+09$('&*)&*) '#9JKZklds^mycmzeo|frzgs{du|du|ev}fw~iwjxlzlzo{p|q}r~r}s~tttuwxzzzz|||}~~~~|yxtsrt~t~ttrqq~p}oynxmwmwiver~bo{_lx]jv\iu\fsakxov4;D#%))+/)+/)+/cinisakxblycmzdq}fsguiwhvhvkulvlvmwmwmwnxoypzq{t|v~wz~~~}{xwt~s}o|mzlykxlyjwjwiviujvjviuiuiuiuiujvjviujvlvlvlvlvkulvlvmwmwmwmwmwmwmwmwnxnxnxlxlxlxlxlymzm{m{m{m{n|n|pzq{pzpzo|o|o|o|p}o|p}p}p}o|o|o|p}q~qqqqs~s~v~wyywyxxyyzzz{z{{{{|ïįįį°ñıIJŲųƳƳƳƳƳƳƳƲųƳƳƲŲűIJŰŰűƱƯİŲűııııİðïĭ®í««¬ë­­­­¯¯¯¯­­­¬{wpkhzcuZgsVcoO[jHTcIS`JTaPZaQ[bW`dW`d[af\bg_elhnuir}js~gv|gv|hw}gv|iu}iu}jwiv*CL!  %$IVTgtrl{kzn{n{n{mzkyhvdq}\iuZ`mHN[?@N=>L?FO[bkr{ïð°°°°±ðıűưŰŰůįĭ¬xw|ŷǵȶɵȵȳȴGU_IWaKZ`JY_IW_IW_IVbIVbLVcLVcNXeOYfOYfOYfOZeOZePZgQ[hQ[hS]jSakTblWemZhpZhr\jt_lxbo{drzft|fw~gxfyfygygyhzmvxxyxwsro}o}o}n|n|n|k{k{j{gxdu|bszbpz`nx[isYgq\grdozCJM$+."!*&#()#() GTZ`msbq}^mybpzcq{br|br|cs}cs}ft~guiwjxjyjyjyl{n{o|p}q~qrrrtuxxz{{|}}~~{ywtrrt~t~t~t~rrq~o|mzkxkxjwgtcp|`my_lx_iv]gt^fsemzkqv%+0)-,+*.+*.$(- -3hu{fs_lx`myanzcp|er~gtgtgthuivivkulvmwlvpxpxqyrzt|v~v~y{|~~~|zx~x~v~t|r|pzlylyjwjwivjwjwjwiujviuhtiuiuiuiujtkukukulvkuiuiujvkwkwjvkxkxmwmwmwmwmwnxlxkwlxlxlylynxnxoyoymzn{n{mznznznznznzo{o|p}o|o|o|o|o|o|o|p}p}p}p}p}q~q~q~rt~t~uvuvvwwxxyy{zzz{}~~~~ïį¯¯°ñııIJŴŵƴdzƳƲųƳƲųƳƳƲŲűIJŲŲųƲŲŲűıııııİŰŰůįįįįį¯¯¯¯¯¯¯¯¯¯¯¯®}zvrmzgt\fsZdqQ[hKUbKS`LTaPZaR\cT_cVae[af]chchqkpyjs~js~hu{iv|iv|iv|ku}ku}iwm{ixfuft~ft~lv}jt{fqueptdositxpzpzmymyl{l{l{l{n{lyitalwY`pFM]7?L8@MOW^lt{°®¯ðİıűűűųƳưŰŮŮŬìë««xwx{~òóȳȳȳȳȳGU]IW_IX^HW]IW_HV^HV`HV`KVaLWbMWdMWdMWdMWdPYdPYdQZeS\gT]hT]hU^iXalWckZfn[go]iq_jubmxdozhs~gu}hv~ey~fzgygylyq~txxxxvsqo}n|n|n|mzmzjzjzizfw~cs}aq{`o{^myZiuWfr[isft~7@C"%(# ,'!(+!(+LX`cow`o{^my_oy`pzcq{cq{cq{es}ft~hvhviwkxlylymzmzn{o|p}p}p}r|t~wxz|{{z{{|~}|yvrqprrrrrrp}o|lylylvkuhrdn}bl{`jy^hw^hw_gtgo|jor,,,+*.*)- #+!.6Cjrfs_lx`my`mybo{er~fshugthuhuhujtlvlvmwpxpxpxqys{u}v~xz|~~~|zyx~u|t{q{oylykxlvkulvkujvjvjvjvjviuiuiuiuiuiuhtmtnulvkuiuiujvkwkwkwkwkwnxnxmwmwmwnxlxlxlxlxlylylylylymzmzmzmzmzmymynznznznznznzo|o|o|o|o|o|o|o|o|p}p}p}p}p}q~rt~t~t~uvvwxxyzz{{{{{}~¯¯įį°ñIJŲŲųƴdzƴdzƳƳƳƳƳƲŲŲűıƱƱƱƱƱƱƱƱƱƱƱưŰŰŰůįį¯¯¯¯¯¯¯¯¯¯¯¯®įĮîî~|xvrlzft[htWdpP]iIVbIS`JTaPZbR\dU^bXaeZcg^gkdlskszlr~lr~ls|mt}mu|mu|ku}lv~kvkvjwq~l{m|tutr}kx~kx~o{nzmynzlzlzl{l{n{n{lwfq|[erIS`9?L;ANbjqy¯¯¯°îðűűűññűűưŰŰŮŭīĪ驧vs~z|°ĵǵdzȳȴɳGU]GU]GU]GU]GU]GU]GU]HV^KU]MW_NVcNVcNVcNVcNVcOWdOZeP[fP[fP[fQ]eT`hUbhXekZgk\im]iq`ltblyfp}ft~hvexexfyfylzp~uyxxxusp~n|n|n|n|m{lzjzjzhxfvas}_q{]oz[mxWitTfq]iqeqy167&*)%)(#%)&(,#T]ndm~]jv`my`nvbpxbpxcqydrzes{ft~ft~gujxkylzlzlzm{n|n|o}o|o|r|t~t~uy{zz||}~~~|{xwsrq~rrppppp}n{lylyjwhufsanz_kz]ix[fwZev^hucmz\cf (,++*.+*.#("'7BMhs~bq}^my^my^mybo{er~fsfsfsfsgtgthujwjwkxmxnynyozs|t}v~x|~}~~|{yxwv~u}t|pzoylxjvjwjwkujtjtjtiujviuhthtiuiuiuiuiukukujvjviuiujvjvjwkxjwkxkxjwjvkwkwkwmwmwmwnxlylylylylylylxlxmymymylxmymynznzo{nzn{o|o|o|o|o|o|o|o|o|o|o|o|o|p}q~rrrruuuvwwxzzzzz{{}~~ìïİŰðòųƲųƳȲdzȳȲDZƱƲDzǰŲŲŲųƲŲŲűııįįİůįĮïįıİðððůįįį¯¯¯¯¯¯¯¯¯®ïĮîí­¬}{tqj~cwVhsSepO\hIVbIS`KUbPZaR\cT_cWbfXcg_jngmyjp|lr~lr~ls|ls|mt}ls|ku}lv~kvjuhviwhv~hv~ix~kzjxjxiwiwkyjxkylznynyo{nzm{lzkyft~^kwIVb.;GDIdlydly_jubmx`nvaowaowbpxbpzdr|as~btbtcuewfxgyhzjyjymzmzl{m|n~n~o~psvwxyyz{|}~zxurrrq~q~rq~p}p}n{lylvjthrgqbn}_kz\hw[gv\fu\fuflyU[h>DK%()&)*)(,%$(46;Zbo`hu[gv^jy`my`myanzcp|er~er~dscr~dsdsetgvivjwjwkxlylylyn{p}rwz{}~~}}{zv~v~u}s{q{oylyjwjwhuhthtgsgsjtjthuivhvhvgugujviuivivivivivjwjwjwjwivjwjwkxkxjwjwjvkwkwkwjwkxmwmwlylylylylylylymzmzmzkzl{l{l{n{n{n{n{pzq{o|o|n{o|o|o|o|o|o|o|p}p}p}p}p}q~q~q~rsvvwxyzxxyyz{{{||}}~­¯°ñıIJųƴɴɴɴɴɴɳȳȳȳȳȲǴdzƳƲųƳƳƲŲųƲŲŲŲűƱƱƱƯįįįĭ­¯¯¯¯¯°ï¯¯¯¯įįĮîí­­«|zyxtnarVguM[jHVeIS`NXeQ[cR\dV^e\dkgmtw}vs~ro|t~t~vwusuyzz{zxyzyy¬®ŮűƲDzDZƱƱưŰŲűį|z}}¶òijűDZDZDzEP[FQ\GS[HT\GS[HT\GS[GS[FS_FS_GU_GU_GU]GU]IU]IU]JV^IU]JTaJTaMUbOWdRXeSYfTZfW]iY_l\bo]er`hu_lxcp|es}guhuivkxn{uyxxvtqo}n|m{k|j{iygweudt~dr|aoy`nx]ku\fs\fsV`mLVcJRY>FM!& $)%'+%'+&)*'*+-16=AFVYgcftdnvdnvbnvbnvbnvcowaoycq{br|cs}avavcwcwdxeyjyjykzkzn{n{o|p}p}q~stvxxy{|}}~~}zytsrrrrrq~p}o|mzjwiugshqenbl{_ix]gt\fs\fs_ivpyU^i15:&(-&(-(&,%#)@@Jgn~]dt[gv]ix^kw`mycmzeo|dq}dq}er~er~fsfsfshuivivjwlylylylymzq{t~vyz}~~~~~|zzx~x~w}u{rzpxkxjwhuivivgtisisjtisjtjththtguguguguivivivivivivivjwjwjwjwjwjwkxjwjwjvjvjvjvlvkukumwkxkxkwlxlylylymzlymzlylylymzmzmzpzpzpzpzpzpzpzq{pzq{q{q{q{q{q{r|p}p}p}p}q~q~rrssvwvwxxyyyyz{{{|}~~­­­­®ñıIJųƳƳƴɴɴdzƴǵȵȴǴǴǴdzƳƳƳƳƲŲŲŲŲűıııƱƱƱƱưŰðﯯ¯¯¯¯įĭĭīīīīĭĭī¬í®î~~}{xtguTbq?P^BSaKYaM[cR]aS^bV^eYahX_hU\e[cpU]jQZeNWbQZeR[fU_fU_fVbjVbjWbmValT_jWbmZdl^hpaksbltblsblscnrdosox|s|py}x~~®°įƮůưǰƯŰűưůııİï¯yvz{{óijĵǵdzȳȴɴHQ\HQ\ISZISZIS[HRZHP]HP]GQ^IS`IU]IU]IU]IU]IU]IU]IV\IV\JU`KVaMUbOWdRXdRXdSYeTZfV\hY_k\bn`fr`jqdnuhu{hu{ft|hv~kxo|zzxxtpom}l}k|h{h{gydvcubtbo{`my_iv\fs\dq`huMW_$,#!,0#,0"+/#).#).&+.',/104104AAK__ijryfnubouboubnvbnvaowbpxbszdu|`v{bx}bw~dyezezjyjylymzmzn{o|o|q~rruvwxyz{~}{yxurrrq~rq~p}o}n|nylwjthrfpcm|aj{^gx[fwZevZfu\hwgq~JTa)+5!+&*/$(-&(-"$)"FJVir]fw]gt_ivakxblydozdozcq{es}es}es}fsfsgtivivjwjwkxlylylymzs{v~wy~||{{zxwv~u}s{oynxkwiuiuhthththththuhuhuhuiuiuhtiuiuiuivivivivhuhuivjwkxjwjwjwjwjwjwjwjvjvjviujvjvlvmwkxkxlxkwlylylylylylylylynxnxoypzoyoypzoypzpzrzs{s{s{s{s{s{s{q{r|p}p}p}p}q~q~rrt~uvwxxyzxyyyzzzz{|¯¯°ñıIJŲųƳƴɴɴdzƳƴǵȳƳƵȴǴdzȳȳƳƲŲŰŰŰůįİűıııįĮïįĮîﯯ¯¯¯­ĭīīīīĬìììîîí~}yxuvm~_p~K]mCUeKZfKZfS]dS]dW`dW`dY_dW]ba_e\Z`]V_^W`\U^_XaZ[cVW_OYaR\dO[cNZbO\bVciS`fS`f]bk^clc`jc`jkhlpmqtswpos`fkkqvlt{mu|qz}r{~u~xx®îòDZȯƮǮǰƯůůűưŮŭĬìêwt~}ƳµijǴȴȴȵɴGP[HQ\IS[HRZGS[GS[GS[GS[FQ\HS^HS^HS^HS^IT_IT_IT_FT^GU_HV`HV`IVbIVbKUbLVcOWdQYfQYfT\iTamWdpYfr^kw`myer~ft~gukunxwzxxtpnm~l}j{h{h{gycuas~`r}`o{^my^hw[etZbo]er@IL$)*&*/&*/')-(*.+*.+*.,,-VVVlt{fnualwbmx`nx`nxaoybpzdr|es}dt~eudvewewgyjyjyjykzn{mzn{o|q~q~rtvwxxyz|{yvtt~s}s}s}r|q{oynxmwjtisfpam|_kz^iz\gxZevZev_ixISb,4A(0=),:%(6&)1%(0#). &+ $0SWcnqgjz_gt`hu^kw`my`myanzbo{dq}er~fsfsfsgtgthtiujwkxlylylymzn{p}t~wz|~~}}||}|{zyx~t|s{pznxkxjwhuivhuhuhthththththtiuiuithsiuiuivivivivhuivjwjwkxjwjwkxhwhwixixiwhvjvjvjwkxkxkxkxkxkxkxkxkxlylylylynxnxnxnxnxoyoyoyoypzpzq{q{pzq{q{r|q{q{pzq{q{o|o|p}p}n}n}n}o~r~r~suuuvwxxyz{{zz{{|}~¯°ñııIJŲųƳƴǴǴǴǴǴǴǴdzƴǴdzƴdzƳƳƳƳƲŲŲŲŲŲŲűıııİïįĮîîí­®ï¯¯įĭĭĭ­­­®îîí®{zx{wsgyI[k>N^HXhN]cN]cS^bU`dVaeWbfWbfWbfZajZajZaj[bk[dh\ei\ei]fj^gk_hl`imajnajnajnbjqckrdlsfnufoshquktxluyqw|tztzv|z{}¯ïïñűƱƲdzȲƱűŲƱŰįïïİŭ|tsx{|ƴõĵǵǶȶȶȵFOZGP[GQXISZIS[HRZHQ\IR]HQ\HQ\IS[JT\IS[JT\JR_JR_HR_IS`IS`JTaKS`KS`MRbNScOUbQWdQYfRZgS]jV`m[do^grclwgp{hs~itlvoywyxwspmk~j}i|i|h{ewbt~cr~ap|anz_lx]gtZdqYck]go=DG "#'*+')-')-')-(*.+*.*)-,)+!%SUYio{ekw_jualw`nx`nx`nxbpzbpzdr|er~fsgthujwkxlylylymzn{n{n{o|p}q~t~uwyxxy{~~|xvsrrrrq~p}mznxlvjtisfscp|`l{]ix\hw[gvZevZev\bo@FS !)+*7)(5)*2()1)+0)+0')./16;=Bachdlsaip^kw^kw_lx`mycp|dq}er~er~fsfsgthuhuhuiukwkxlylymzn{p}v~y|~~~}}|{z{zyx~x~t|t|pznxjvhthththththththththshshshsithsititftgugvgvhuhuhthtiuhtiujvhvhvgygygygyixhwjvjvkxkxkxkxkxkxjwkxkxlynxnxnxnxlxlxlymzlymzmzo|n{n{pzpzpzq{o|o|o|n{o|o|o{o{o|p}n}n}n}o~q}r~ssttuwxxyyzzyz{{||}~~¯°űƱƱƳƴǴǵȵȵȵȵȵȴǵȴǴǴǴdzƳƳƳƳƳƳƳƳƲŲŲŲŲűIJDzDZƱƱƱƱİﯯ¯¯įįįįįįįĮ~}{zvwvusN`p 2D/ASBPZAOYCPTIVZIVZIVZKU\MW^PZbQ[cU\eRYbQ[cR\dS]dS]dS^bR]aXcg]hl^im\gk\gk^im`imajn`ilajmissmwwry|sz}tzx~{|¯ĭĮŮŮűƲDzDzDzƲƲƳDZűŰİĭĬëª|tux{}ǵǵǵȶɵǶȴȴDQWFSYCRXDSYCQYBPXEP[EP[FOZFOZJQZLS\IS[JT\IR]IR]GQ^IS`IS`IS`JR_KS`MS`MS`NTaOUbNVcPXeRZgU]jXbj\fnbjqfnugqyjt|nvrzz~xwspmk~j}i|j}h{dt~br|bq}`o{`my]jvYfrVcoZgm\io:BB#&''*+))*(()('+)(,+(,*'+(%'.34QVWZgsZgs^italwbmxbmx`nx`nxbpzdr|fp}hrgthujwjwkxlylylymzmzn{n{o|p}rsuvxxy{~zxtrrqq~p}n{lyjwivgtfseo|bly`jy]gv[fwZev\fu`jyV]f:AJ"!)+0)+0'+0'+0(,1)-2')- Y^aeov_ip]jv]jv_lxanzbo{dq}dq}dq}er~fsfsgtgthujwjwjvkwlxlxn{p}v~y|}||{{||{z{yx~w}t|s{nxnxiuhthtgshththththththththshshshsithsiuiuivhugtgtjtjtjtkujvjvhvhvhwhwixixkxkxjwjwjwkxlvlvjvkwkxkxlykxlylylylylxlxlylylylymzmzmymymzn{pzq{n{n{n{n{o|o|o|n{o|o|p}p}o|p}q~rrrstvvwxxyyyxzz{z|}}¯¯°ðñıijƵȴƵǵȵȵȵȴǴǵȴǴǴdzƳƳƳƳƳƴdzƳƲŲŲŲŲűıİǰǯƯƯƯƯƮŮîí­¯įįįĭ­¬~{{yxxxvxv`v6N[5MZ@T_AU`EU_EU_ANZFS_IVbJWcHUaIVbN[gMZfN[gR_kTblO]gQ_gTbjWem\jr^ltZhp[go\hp\fm`jqfosgptpwzsz}v|v|x~|¯įİűƱƲDzDzDzDzDzƲƯůŮĭ쫬vy{|IJIJĵǶȶȶȵɴAOWBPXBPXCQYBPZBPZDOZEP[FOZGP[JP\JP\HQ\HQ\HP]GO\GQ^HR_HR_HR_HRaHRaKS`KS`KS`MUbKUbLVcMWdOYfS]jWanYfr]jvanzdq}ivmzwyxwurp~o}k{k{jygvcr~ap|bo{anz`my[ht\dqX`m`frZ`l7>A  (((''(''($&*%'+$&*$&*#%)1;BKU\ZgsXeq[ht]jv_lx`my`nx`nxaoybpzer~fsdsetgvixjzjzjyjyjykzjyl{o|q~rrtvwxyz}~}xqqp}q~q~o|mzkxhuhugtdq}cm|^hw^hw]gvZevZevZfudpRV[37<)+&,*0,*0)+/*,0*,0+-1*+3%\`lbly\fs\iu]jv`myanzbn}bn}bq}bq}cr~dsdsdsgthuiujvkwkwlxlxmyo{t~v{|~~}}|{{z{zx~w}t}r{nxmwiuhthshshtgsgthuhuhuhtgshthththththththtgsgsgsgsiuhtiujvjvjvhtiuhvguhwhwixixkxjwjvjvjvjvjwkxkxkxkxkxkxkxlxlxjxjxjxjxlxlxmymymymymymynznzn{n{n{n{o|o|o|o|o|o|o|o|o{o{p}q~q~rr~ttvvwxxxyyzzz{|||~~¯°ñIJųƳƴǴǵȵȴɴɴǴǵȴǵȴǴǴdzƳƴdzƳƳƲŲŲŲŲŲűıııįƯƯƮůƭĭĭįįįįįįĭ¬~}}|{zzzzywuxxzztvywsuwtww{zy|}zxzyw|}ªëĮůƯƯƱƱƱűŴƴƳŲIJıî¬|tux{}ݲıȱȲɲɴɴCMZDN[CNYDOZDOZDOZEP[DOZFOZFOZGP[HQ\KQ]IO[HQ\HQ\FQ\GR]HS^HS^HR_HR_KS`KS`KS`LTaLTaMUbNWbPYdQ[cT^fYbm_hs`mydq}gulzx}xwurn}l{hzhzeyau`t]q|_nz_nz^kwZgsVcoTamXdlGS[2::#"$('$&*$&*$),%*-%).%).$),6CIIV\VcoVco[er^hubkvclw`nx`nxanzbo{dq}er~fsgtiwjxkylzjyjyjyjylyn{o|p}q~rsuyz{|~~xto~o~o~n}p}n{lxiuhtfrepbm~`iz^gx]gv\fuZgsYfrZgscp|KPQ"#)+&,.)+*.+*.+*.+*.-*,-*,))*#dlsanzZgs]gt^huakxblycmzeo|cp|dq}er~er~fsgthuivivjwkxjwlymzmzo|t~t~z|~}}||{{{ywv~u}t|rznxmwiviviuhtgsgsgsgshtgshtgshtgsiuiuhththththtgsgthuiviviujvhvhvguguiuiuiuiujwjwkxjwjwjwjvjvjvjvjwkxjwkxkxkxkwkwlxlxlxlxlxlxlxlxmzmzmzmzmzmzmzn{n{o|n{o|o|o|o|o|n{n{n{o|p}p}q~rt~t~uvy{yzxxzzzz{{~¯°ðòŲųƴǴǴǶɶɴɴɴɴɴɵʵȵȳƳƴǴǴdzƳƲųƳƲŲŲŲűıįƯưǯƯƯƯƮŭĭĭĭį°ï¯¯®~|}}}|yzxyz{|~}|~}{~~~~~~~­îĮįůƯƱƱƱƲǴdzƲŲŰůĪ«éyuvz~ʲóijŴƴȴȳȳANZANZBO[BO[CMZDN[FN[GO\FN[GO\FQ\FQ\FQ\FQ\EP[EP[DR\ES]ER^ER^ER^ER^HR_IS`IS`IS`KS`KS`MUbNVcPXeQYfU^i\ep_judozetgvsyxvtrp~n|k{jzhwfubq}_nz`my`my^kwWdpUbnTamWemCQY0::#)(#)(#)($*)&+,',-',-&+,%(0%;CPIQ^P[lS^o[cp^fs`kvalwalwbmx`myanzbo{cp|fsfsgtivhwixhzhzhzhzjykzn{o|q~rstxz{|}~}}}{vsqpo~o~p}lykwhtgsfrcn`k|`iz\ev\fu\fuYetXds]gtdn{BEF*&&.**,)-,)-+(,+(,+'-+'-! $*.erv_nzXgsZgs\iu_lx`myanzbo{bo{cp|cp|dq}frfrgshtivjwhwixixjyjyl{q~rwz~~}}zyxwv~u}s{rznxmwivivhtgsgsfrgsgshtgsgsgsgshthththththththththththtiuguguhvguguguiuiuiuiujviujviuiujvjvjvjvjvjvjvjvkwjvkwkwkwkwlxlylylylylylylylykzjyjyjylxmynznznzo{o|o|o|n{n{n{nzo{o{o{p}rrrssvxxyzz{{|||}}~~«¬íĭįİűIJŲųƳƴǴɴɵʵʵʴɴɴɵȴǴdzƴǴǴdzƳƳƲűIJŲŲŲŲŲŰǰǰŰůįĮŮŰůįįįįįįĮîî~}||}}|||xxxyyxz{{zz|yyzyz{zyzz~|}|||~~«ì­íîĭŭŰǰDzƲƲƱűŰĮŮūīĩ§~xxy|}ǴŲóǴȴȴȴɴAOYAOYCNYCNYFOZFOZGMZHN[FN[GO\GR]FQ\FSYERXEP[EP[EO\FP]GR]GR]GR]HS^HS^IT_IS`IS`IS`IS`JTaKUbKUbMWdPZgU_lYgq`nxft~kyw|wvtro}n|m{lzhxeubr|^nx`nx`nx\jtWeoTblR`jXfnN\d3Idmxclw]fq^gr_hs_ivakxbmxcnycnydozep{fq|gq~hrhrisgthuiujvjwkxlyn{p~sz|~~~~}}|{xv~t~r|nzlxlxkwiugsgtgtishrfshuhtgsgsgsgsgsivivhugtgtgthuhuivivhuhuhuivivivivivivhuiujvjvjviuiujwjwjwjwjwkxkxkxjwjwiwiwjxiwiwiwiwiwkxlylylylylyjyjylymzmzn{n{n{n{o|o|o|o|o|n{o|o|o|o|o|n~opprrstwyzzz{yyzzz{{{~įį°ñòijŴƴǵȵȵȵȵȵȴǵȵȵȳƴdzƲDzDzDzDZƱƲųƱIJŲųƲųưŰŰůįĮñİﯯįįįĭŭŭŭŬìî}}}}}~||}}}}}}}}|||||||||||}}}~~~~«¯ïñűűŲƲƲƲƲƱűűŰİŰŮí­«{vyz|~ȳDzƵǵǶȶȶȶIY\JZ]L\_L\_M]`L\_L[aM\bKZ`JY_IX^IX^HY_FW]FW^GX_GWaHXbGYcFXbEWaFXbFXbGYcIYcHXbHWcHWcHWcIXdIXdIXdFUaKZfM\hRam^lvkyx{xxqpki}f{dybw_t}^p{]oz^my]lxXgsUdpRblQak\io?LR#$ #()!&'!&'#()')-(*.+*.*)-&%)>DKQW^U_lR\iTamXeqYis[ku\mt\mt`my`mybo{dq}bu|bu|cv}dw~ewfxgygyjyjyjyjyn{n{o|p}rrtvxz|~~|xtrqn}n}m|jygvdsdsds`o{\kwYgvXfuXfuVdsWcrUap]goZdl (((((()(,,+/*,0+-1-01,/0)+0+-2;AN[anZgsXeqZgs\iu^kw`my`nx`nx`nxbpzbo{dq}er~fsfsgthuiviuhtjvkwlxmyr|t~wz~~~}||{yx~w}v|rzpxlykxhufsfrfrfqfqgsgshthtgsgsgshththtgtgtgtgtgthuhuivhuhuivivguguguftivivivjwkxjwjwkxjwjwhwhwixixkxkxjwkxiwiwjxiwhvhvhvhviwhvkwkwlylylylylxlxmynzn{n{n{n{m{lzm{m{l{l{l{m|m|m|m|n}n}n}o~prrtvwwxxyzyzz{{{|}~¯įİñIJIJĴǴǵȵȵȴǵȵȵȵȵȴdzƴǴǴǴdzƳƳƳƳƳƲűIJųƲŲŲŲűııııİﯯ¯įĭĭĭ­­¬~~zzzzxxyz{z}}||}}~~}}~~~~~~||}}}}}~¬­íîİıűŲƲƲƲƱűƱưŰŲıï|vwx{~ȹȷƶƶƶȶȴȵQadTdgTdgTdgTdgVfiUckWemTbjQ_gQ_gUckPcjPcjOakOakNclQfoPdoNbmPdoQepPelPelShoShoShoQfmNclNclOcnOcnQcnTfqRblM]gWdpkxz{xxroj|i{hzfxcu`r}^p{\ny^my[jvXgsTcoQ`lRam^jr9EM#*-"**!))#)(%+*&,+'-,)+/')-')-;CJNV]VcoR_kSakWeoZhp\jr\jr]ks_lx`myanzcp|cs}cs}dt~dt~fugvhwixjyjyjyjylymzmzo|q~rtvwx{~~}zxtrp}m|l{kzjyftdrdrdr_m|[ixYgwXfvXfvVdtWcrWcr_foQXa! '&*'&*(&,+)/-,0/.2.12+./').249?HST]hWdpXeqZgs[ht]ku^lv`nx`nxaoyaoybo{cp|er~fsfshuhuivivivjwkxlymzq{t~xz}~~~~}}{zyyv~t|pzoylykxfudsfrfrfrfrgthugthugtgtgshtgsgsgthuhugthuhuiuhththtiuiugvhwgvgvgvhwhwixixixhwhwhwhwhwixixixixhwjvkwhviwiwiwgugujviujvjvjwkxlylylylylylylymzmzmzmzmzkykyl{l{m|l{kzkzkzl{n{n{o|o|p}rrrstuwwxxxxyz{{||}~~­­®ðñIJŲųƴǴǴǵȵȵȵȵȴǴǴǴǴǴǴǴdzƳȳȳȳȲŲűIJŲŲŲDzǰǰǰůįįĮîﯭĭĭ­­­­¬¬êéªê~|{yxxxvwxyzz|}}}|}}}}}{{||||||||}}}}~~~íĭĭİıűŲƲƳDzıðŰŲŲŰŰŪé¨|tux{~ƶŶŶȶȶȵǴȶGQYJT\ISZISZJT[MW^KW_KW_M[eO]gR`jXfpTblP^hO_iUeoYgq[is\jtZhr^lv_mwZhpZhp^ms`ou`nv]ks\gr^it`nxcq{cqybpxUcmN\fP]ihu|{xxsqk{k{jygvdsap|^my]lx\kw[jvXgsTcoP_kP_kVbj1=E%,/"+)!*("**#++&+,&+,(+,&)*%'+=BKOT]V^kS[hT_jXcnZhr[is\jt]ku_lx`my`mybo{cq{dr|dt~dt~fufugvhwixixjyjylylyoypzr|t~tvwx~~{yxtpm}m}l|lykxgsfrfreq`l{ZfuZfuYetXctVarVbqWcrXalDMX!"(&,'%+)'-+)/)+/,.2,/0*-. #+03;@HURZgTamVcoZgsZgs\jt^lv_mu`nv`nvbpxbpzdr|dq}er~hrhrfshuivivjwkxkwlxryt{wz~~~}{zyywv~t|s{oyoylyjwgtfsfrfrfrgsfsgtgtgtgtgtgsgsgsgsgshththtgsgsgsgshththtiuiuiuhthtivivjwjwhwhwhwixhwgvhwhwixhwguftiuiuiuiuiujvjwjwgvgvhvhvjwkxjwkxkxlykxlylylylylylylylxmymzn{nzmymymymynzo{nzo|o|o|q~q~q~rstvvxxxxyzzz{||}~~­®ðñIJŲųƳƴǵȵȵȵȵȴǴǴǴǴǵȵȴǴɴɴɳȳȳȳƲŲŲųƳƳȲDzDzDZıįįįĮí­­ĭĭ®í«««ª~}{yxxxxxxyzz{{{{{{{}}{{|||}|}}~||||~}}®¯ò³óôĴĵųóóųŰıůŮĪé¨ztwx|ųµŵŵǶȴɴ"'#")#)('%.".'-9'-9,2>)1> (5"/'1>%2>#0<#0<)5$1=.;G.9D&1<,7B1GXEL\EL\AM\@L[1=L#2+8D`myx{tsrpm{lzhwetcr~_nz^kw^kw_lx^kwZhrTblR_kQ^jZdk3=D&+,%()%()%'+%'+%',&(-$&+$&+!"*N8;K7?L7?L,7B (0]gou}rro}m{lzhvfsfsbo{_lx_ix^hw_ix_ixWdpS`lP]iQ^jYdh-8<$*)#(+"'*#%)#%)#%)"$(&%)&%)#!' >BNOS_QWdQWdSYeW]iYck\fnZhr[is[ht]jv^kw`mybo{cp|dq}fsfsfsgtgtivjwkxlymwnxnxoyrzt|t~vxz|~|zvrp}n{n{mzlyivfsfsdq}bo{^jy[gvZfuXdsWcrVbqUbnZgsR\c+5<*.-)+0)+0,+/-,0--.../,,-,,-"$(.04BHTOUaS[hX`mZep\gr[ht]jv_lx`my`myanzbo{bo{cp|dq}er~er~fsgtivjwjwivjvlxrzt|wz~~~}|||{zxxv~v~r|q{n{lykwjvhtgsesdrdrdrdresfsfshrhrhrhrjqjqhqirhsgrgsgsgthugtgtgthuhthtiuiuiuiuiuiuithsititititititjvjvjwjwivivivivivivivhuiuiuhvhvhvgujwjwivivjvlxlylylylylylylylylxmykykykylzlzm{l{m|n{n{n{p}r|r|s}t~uuvxyzxyzz{|{||}¯¯°ðñIJųƴǴǴǵȵȳȳȳȲDzɲɲɳʳʲɲɲɲɲɱȲɳȳȲDzDzųƲųƳƲűİïįįĮîí¯įį¯¯¯®®¬««ª~{zxwwwxyyxxxyyyyy{{{{y{{{|{{|||}|}}}~~~±ñòıñïůůůůůŮĭì뫪wtvz}~Ǵõĵǵdzȴɲɲ%+0%+0%,/%,/&,1%+0%+0%+0)+0*,1-*3-*3,)2,)2)*2)*2'*2),4*,6*,6-/902<35?46@57A68B68D79E87E98F98F98F96?74=32?"##4^^osz|p~p~n|kyishrfp}cmzbly`jw^hw\fu\fu[etV`mQ[hN[gO\hV_b(14&*)%'+$&*"'*!&) (( (( (( (((& 9DHGRVMTdMTdPXeS[hTblVdnWeoYgqZfu[gv]ix_kz`nx`nxcq{dr|fsfsfshuhuivjwivivivmwnxoyq{u}wx{|}~~{zuro|n{mzlykxgtfser~bo{`my\iuZgsXdsWcrVbqUapTamZgsNZb+3!%.,,+/,+/,,-,,-,,-,,-,,-++,#"&104HMVOT]S[hX`mXboZdqYfr[ht]jv^kwakxblycmzdn{cp|dq}er~fsfsgthuivivivivlyn{p}v~y{|~~}||{zv~v~p}o|mzlykxivhtgsfrgsesdrdrdrdrdrfrfrfqfqgsfrgsgsesesesdrdresfrgsisjthththtiuhthtiuhthtiuhtiuiuhththtiujvivivivivhuhuivhuhththtiuguftftguhwhwhwgvjvjvkwkwlxlxlxlxlxlxjxkylzlzlzlzlzlzlzm{lzlzo{o{p|p|p|r~r~r~tvwwxxyz{{z{|}}~­®îïįİŰűIJŲųƴǴǵȵȵȵȴǵȴɵʴɴɵʵʴɴɴʴʴɳȳȲDzDzDZƱƱIJŲŲűııİððﯰï¯įį¯¯®¯®©©©ª|zywvvvwvvwxxxxxxxxxxxyyyyzyzzyyzz}}}~~~¬¬­îįűŰIJijűűŭŮƭŭŮĭì«ysvx|}ȳijĴƴƴɴɳʴ$..$..$/-$/-%.1%.1&-0&-0(-0).1)./(-.%--&..&..'//&..'//'11)33+55-77/8;/8;09=/8<17>17>35A24@44>22<3092/82-< *$'7WZjqyyr|r|oxluhofm}cm|akz_iv]gt\fs[erZdsZdsV`mQ[hO\hP]iQZ] ),','%()%()#(+#(+"+)"+)!*&!*& +)(&:DKDNUHR_IS`KUbOYfP]iS`lTamWdpXeqZgsZgs]jv^lv`nxaoybpzcp|er~fsfsdvewdvdvhuhuivivowqys{v~v~y{|}}{xt~r|n{lylykxivfsdq}bo{`l{_kz\hwYetWcrVbqUapT`oT`oZfuQZe#. %(',/+*.*)-+(,,)-+(,+(,(&,&$*206IMYOS_RZgW_lUbnWdpXeqZgsZfu]ix`jwblyblycmzbo{dq}eqeqeqfrgtgthuhukumwqys{v~y|~~~}||{yv~v~p}n{lykxjvhtgrfqfrfrdrdrdrdrfqfqfqfqfqfqfrfrgsfrfrfrdrdrdresgthugsgshthththtiuiuhshshsitiujvivhuguftgugugufththththtiuhtithshsithshshtiuhwgvguguiujvjvkwkwkwiwjxjxjxjyjykzkzkykykylzlzkykzl{n{n{o|p}p}q~q~rstuvwxxzzzzz||}~~¯¯°ñıIJųƳƴǵȵʵʵʵʵʵʵȵȵȴǴɴɴʴʴʴʴɴɳƳƳƲűƲDzŲųƲŲŲűıİﯯ¯įįįįįĮ¯®­­­­­­¬}|wvt~t~t~utuvwvvwwxxxxxxxxyyyyzyzz{{{|~~~~~®®­ííîİİݱïïðįïŮĮĮĭë}wwxz}~˳ĴŴƴƴȴȵʵ&/3&/3&00&00&/3%.2'-2'-2(.3)/4'04&/3$02%13&24%13'35'35(37)48*59,7;.7;.7;06;/5:1371372152150.4,*0.,2.,2.+5)&0 #1PSaqwx~qyqynu~jqzhn{flybhu`fs_er_er]cp\boZboX`mS`lP]iOYfPZgX^e+18$&*$&*$&*#(+$),"+)"+) **(($+"*1>DPDJVGNWKR[MS_OUaRXdTZfV_jXalZbo\dqZdq\fs\jt^lv_mw`nxanzbo{dq}dq}fsfsfsfsfsfshrhrltowtzu{x~yz|~~zvs}oynxlvjwivfrdpcm|bl{bly`jwZgsXeqVbqVbqT_pT_pS_n\hwNT`(%#)+)/+)/)'-)'-)'-(&,(&,$%-"#+$/5AHM]MRbRXeV\iWaiXbjYbm[do]er^fs_gtaivckxdlydn{fp}fp}gq~gqhrhrhrksltmuowqys{w}y|~~~~}}|{yv~u}p}n{lylyiugsgrfqfrfreqeqfrfrfqfqfqfqfqfqfqfqfqfqfqfqdrdrdrdrfrfrishririrgshtiuhthtgsgsiuivivgvfugvfugufthththshsithshththththtiuhthththtguftguguhtjvjwkxixixixjyiwiwixjylylylylymymymzn{mzn{n{o|o|o|o|p}q~q~rsvxxyzz{{|}{|}}¯¯°ðñIJŲųƳȵʵʵʵʵʵʵʵʵʵʵʴɴɴʳɳɴʴɴɳȳȲDZƲDzDzDZƲDzDzǰŰŰŰůį¯¯¯¯įįįį¯­­­­­«­«~|zxuuv~v~v~v~t~uvvvwwxyyxywxxxxxxxzzxyzzz{{|®®¬­íîİİİ°¯ïïïïŮĮŮŬìêy{y|~ʱıIJȲȴȴȴɴ%.1'03'11&00)03)03,.3-/4-/4-/4+/4,05(14(14)42)42+64+64,58,58,59.7;15:049/47-25-/4,.3+,4)*2()1)*2)*2*+3++5&&0#"0QP^mp~uxlv}ku|is{dnvaju_hs[erYcpVcoUbnTamTamTamS`lP]iMZfNXeOYf^cl9>G#(%/&%)'&*$'(%()'*+&)*%'+$&* ",(*4>DPBHTDNUGQXHP]JR_LScPWgNZiQ]lS`lUbnYcpZdqZgs[ht\iu]jv`myanzdq}cp|co~dpeqeqco~co~dpdpfrgslvoyryv}w~x{}yvn{jwgtfsfreqco~am|bl{akzbjw_gt^eu[brWapV`oT_pR]nQ^jXeqCKR &&'++,+*.,+/',/',/(.-'-,%,/%,/(02DKEKR>FS@HU@HUAIVCKXEMZDN]GQ`JTcMWfQ[jS]lV`oV`oV`oV`oYcr\fu\hw^jy`l{`l{^l{]kzWhvWhvXfuXfu^hwakzfn{jrntrxtzu{u{u{qzpyiv|dqw_mw_mw^kw]jv\hwZfu\fu[etZdsYcrVarT_pS_nQ]lR\kQ[jT\iQYf25=$"((&,)'-+)/)+0*,1.,2,*0+(1*'0'(6?@NGL\HM]JQaLScLTaMUbOWdQYfS[hT\iW^nX_oZbo]er_gtckxbl{dn}fpgqhrhrhrishtiuitjunxr|v~x~~~|{{{zyxwx~w}u{tzpxowkuisfreqeqeqfrfrfqfqeqfrfsfsfrfrepfqhqhqhqhqhqhqgphqfqfqesdrfqfqfrfrgthufsgtgsfrfrgsfrgshthtgshtgsgsgshtftftftftftftgshthuivgvgvfufufteshththtiuguguftguivjwjwjwjwkxkxkxlylyjyjyjykzkzjykzkzn{n{o|o|p}q~q}r~stuwxxyzzz{||}~~îﯰñİñİŲDzdzȳȳȳȲǴɴɴɴɳʳʳʲɲʲʴɴɳƳƱƱƲDZƱƱƳƳƳƲŲűıİﯯ¯¯¯®îììíī«««ªywtro{mymymymymyn{o|o|o|o{o{q}q}rrrrsssttstttusststtwxxyz|~¯ĭĮŮŮűƱƱűűűűŰĮŮŮŭī©w}uzx{ƵĵĴƵǴȵɵʴ)25)25)25*36,36,36,36,36,36,36,36-47,36,36*44*44+42)20../,,--*.+(,))*))*$'(#&'#%)#%)$&+$&+$&*&(,&)*'*+)+/)+/$-?FO^hunxbnvamu\jrVdlTbjP^fOYfMWdLVeMWfMWfNXgMYhLXgJWcIVbMZfHUa?EJ"'%%%%%&%%&#%)#%) &+!',!', &+&(-(*/46:@BF@HHBJJCIPDJQCJSDKTEOWFPXJS^MVaQYfT\iV^kW_lU]jT\iX`m[cp^fsaiv`jw`jw\kwZiuXgsWfrYfrYfr\fs^hudlyhp}ku}oyryt{t{t{qzoxiu}bnv^it^it^hu\fs^fs]er[cpZboYanX`mV`oU_nT^mS]lR\iPZgS[hKS`.3< !#'%'+&(,(*.)+0*,1,*0,*0,(..*0206FDJHNUIOVGP[IR]IR]KT_OUaRXdSYfSYfU[hX^kZ`l]co`frciudmxfozhp}jrjrjrhrisjtjtkumwpxrzvx|~~~~}}||zzyx~v|t|rzpxowjshqfqfqepepfqfqepepfqfqfqfqepepepfqfqfqfrfrhrhrfrfrfrfrfrfrfrfrfrfrgsgsfrfrfrgsgsgsfrgsgsgsgtgtfsgtgtgtgshtgsgsgthugthuhuivfufuewewewdvhththtgsduevfxfxivhuivjwkxkxkxkxlylylylylylylylylymzmzn{n{n{q{q{r|t~uvvwyzxzz{{|}|}~îﯰðñııIJŴǵȵȵȳȳȳȳȳȳȳȳȲDzDzDzǴɳȳȳȲɲɲDZưŰŲŲŲűį±İðﯯ¯¯®îìììë««««­}{yvsro{nzmymymzmzn{mzn{n{o{p|p}q~q~rrrpqrrstttutrsssuvwxzz{}~~®¯ïðİıűŲDZƱưŰűưįïî­}q|o{uz}ƲűijDzƳɳɳɳ-25-25-25-25-25-25-25-25-16-16-16-16-16-16/15-/3*.-)-,++,))*'&*'&*'&*'&*#%)#%)!&)"'*!&)"'*$&*$&*&)*(+,)+/(*.!-?COekxoucmtbls\ioVciR`hN\dMZfKXdJWcJWcKXdLYeOYfMWdLVcKUbS]e?IQ*36(+"%&"%&"%&"%&"$(#%) '*!(+!(+!(+&)*),-,,,888BBBFFFEFNGHPAHQBIR>LVAOYDQ]GT`MWdPZgS]jS]jO\hO\hS`lUbn[er\fs]jv]jv]jv\iuYfrWdpWdpXeqZgsZgs^kwbo{gq~kurxrxrxrxpynwft~`nx\iu[ht\fs\fs\dqZboYanYanX`mX`mU_nT^mS`lQ^jO\hMZfX`mGO\57C(%#))'-')-)+/)+/*,0-,0,+/+)/,*0317IGMNNXLLVGMYIO[HP]JR_IS`LVcMWdOYfOYfS]jW_lZbo]er_gtbjwemzeo|gq~gq~hrfsgtgtgtjtlvpxrzvw|~~~~}zyyxwwv~u}q{oynxlvirhqgpgpepepepepepepepfqfqfqepfqfqfqfrfrfrfrfrfrfreqfrfrfrfrfsfsfsfsfsfsfrfrgshthtgsfrfrgsgsgtgtfsfsgtgtgthuetetfufufufuhuhugthuhuivivivgvgvftftduevewfxgvgvivjwjwjwhwixixixixjylylylylymzmzlymzmzn{o|o|p}q~rsstuxxyzz{||||}Įíĭĭ­®ïııijƴDzdzȳȳȳȳȳȳȳȳȳȳȳȳȳȲDzDZƳȴɴɴɳƳƳƳƲŲŲŲŰðððïįį¯¯¯®®}{ywsq~p|mylylylymzmzmzmzo|o{o{p}q~p}q~o~pppqqssssttrsssssvwwxxz||}~~~~~~~­­®°ĮįŰưưǰDzǯİűưİį{sruxz{DZűųɳɵɶʵɵ/15/15-25-25,36+25+25+25+25,36.36-25/15.04001,,-**+(()('+&%)&%)&%)&%)%$(%$(&%)!%*!%*!%*!%*!%*"&+%',').%).$(-+@CQgjzqtelucjs[hnWdjQ`fM\bLZdJXbIVbHUaKUbLVcMWdLVcQZePYd;CJ"*1!$%("$("$("%&"%&"$("$($&*$&*&(,&(,++,,,-,+//.2:5>@;DBAOEDRAHQAHQ>JRAMUCMZFP]LTaPXeRZgS[hN[gMZfO[jR^mVbqYet[ht\iu\iuZgsXdsWcrVbqWcrXdsZfu]ixam|fp}ispvrxrxrxpxnvgq~bly^hu\fs]er\dqZboYanZ`mZ`mY_lX^kV]mU\lU\lT[kRZgV^kZ`m67>DAJFCLAGNBHOAHQCJSFLYGMZOP^STbSZcSZcMZfMZfMZfO\hW_l[cp^gr`it\iuZgsXdsVbqUapUapWcrYet`jwblyhp}ksourxtwtwowltdq}^kw\hwZfu[brY`pY`pY`pZ`mY_lX^kX^kV\iV\iSZjRYiV^kPXeFJV&*6#!')'-''((())))))))'-+)/+)/*(.*(.+)/-,0215>=ANMQNLRPNTJPWLRYKR[MT]NTaQWdSYfU[hV\hX^jZ`l]cobesgjxdlygo|er~fsfsfshrhrhrjtnvpxv}x|~~~}||{wwwv~t~r|o|mzlykxgsfrhqgphoipipipkq~kq~iq~iq~gqhrfrfrfrfreqfrfqfqfqfqfqfqhrhrhrhrfsfsfrfrfrfrfqfqhrhrjqjqjqjqhrhrhrhrgqgqhrhrfsfsfrgsgtgtgtgtfrgsgsgshtgshuhufuetetfuguftevevduduevduftfthuivjwjwjwkxmwnxnxnxlymzmzmzn{n{n{o|o|p}p}rrsuwyzyz{{~~~¯¯¯°òŲųƴɴɴɴɵʵʵ˵˵ʴɴǴdzȲDzDzdzȲDzDzǴǴdzƳƳƳƳȲDzDzDzDzDZưŰŰŰůįįį¯®í®îî|zxwtro|mzmzlymzlymzmzmzmzn{n{o|p}p}p}q~q~q~q~rrstttsttttsuuvvwwxyy{|}}~~~¯°ñ³ñŲƲDZƱƱƱưŰŰůî­­«~s|u~y|ɵĵĶȷɷɷɵʷ,*0,*0-+1-+1-+1.,2,.3+-2+-2+-2.,2/-31/5/-3,,-(()%%&%%&%$(%$("$(#%)#&'#&'#&'"%&"$(#%)#%*#%*#%)$&*%'+&(,&*/%).+=AMahxjqbls`jqZgmVciM[cJX`HV^GU]IS`IS`KS`LTaPVcTZgMNV56>$"(%!.%!."$("$(#&'"%&#%)"$(&$*&$*&$*'%+)'-)'-(&,*(.,*0428;=BACH?FO@GPAGTBHUDIYGL\GO\JR_KUbNXeLYeKXdLXgMYhS]lWapZfuZfu[htZgsWdpUbnUbnVcoWbsYdu[gv`l{fp}hrouqwrxrxpxksfn{bjw^eu]dt[brY`pX`mX`mW_lV^kU]jU]jT\iS[hQ[hQ[hR^f3?G '* '*&(,$&*'&*'&*'&*)(,)'-)'-*'0)&/+(1+(1-,0)(,,,-AABGIMJLPGNWHOXJP]LR_KS`NVcOYfPZgP]iR_kV`mXbo]dt`gwblydn{eo|gq~er~fser~er~eqfrjtnxrzu}z}~~~~||{zyywv~v~t|pzoylykxhtfreqeqgqgqiq~iq~iq~iq~gq~gq~frfrfrfrfrfrfqepfqfqfqepfqfqfrfrhrhrfsfsfrfrgsfrfrgsfrfrfrfrhqhqgsfrfrfrfrfrfsfsfsgtfsfsfrgsfrgsgtgtesesesesftftesesesftesftftguftftftftesftgvgvhwixjwjwjwkxkxlylylylymzmzn{n{o|o|o|p}q~rsvxyzz{z{{||}}~®¯¯¯¯®ïİűƲɳʲɳʳʳʳʳʳȳȳȳȳȳȳʳʳȲDzDzǴǴǴdzƳƳƳƳƱƱƱƱƱƱƱıį¯¯įį®¯¯®~|zxvt~q{oymzmzlylylymzmzn{l{kzm{m{o~o~q~p}p}q~q~rrsststttttuvstwwzzxzz{}}~~~~~­®¯ï±òIJƲƲƱűƱƳŲİİįî­}qzr}wxzzĵdzŴƵɶʵʵʶ˶)(,('+)(,)(,)(,*)-+)/+)/+)/+)/,*0.,20/30/3),-%()"%&"%&"%&"%&"%&#&'#%)"$(#%)"$("$(#%)!&) %(!&)"'*%'+&(,(*/(*/".>BN`izkt_ju]hsZepU`kM[eIWaGU_GU_IS`IS`KS`LTaQWcY_k?>B!)$&*%'%$(%$("%&"%&"%&#&'"%&"%&%%&%%&&%)&%)&%)'&*('+('+*)-.-18:?ACH=EL?GN>GR?HS@ITCLWENYHQ\IS`LVcLVcLVcLVcMWdRZgW_lXbo[erYhtWfrTcoSbnUbnUbnUapWcr\evaj{in~lqntpvqwrxowjreo|_ivZgsXeqVcoUbnV`mU_lV^kU]jT\iT\iS[hS[hT^kQ[h@KV#.9$"*1#&."%-"&+#',%',&(-)'-)'-)'-+)/)*2)*2)+0)+0*)-437A?ELJPKMYKMYIO\LR_KS`NVcNYdOZeN\fQ_iV^kX`m[cp_gtbjwdlydn{eo|er~er~dpco~eo~gqjrnvr{u~z}~~}|{{zwwv~v~u}rzoyoylxjvgsfrfreqer~er~gq~gq~gq~gq~fsfsfrfreqfreqeqeqfrfreqepepeqfrfrfrfrfrfrfrfrfrfsgtfsfsfrfrfrfrfrfrfsfsfsfsfsfsfsfsfsfsfsfsfrfrfrfrfrfresdresesfrfrfrgsgrgrgrgrgrhsgsgsgsgsgshthuivivjwjwivkxjwlylylylylylymzn{n{n{n{n{p}q~rrrtwyxyz{||||}}®¯¯°ïİŰűƲDzDzɳʳʳʳʳʳȳȳȳȳȳȳȳȳʲɳȳȳȲDzDZƱƱƳƲŲŲűIJŲűİůįįįįĮïįįį¯®|{xvus}pzoymzmzlylylymzmzmzmzn{nznzo|o|o|o|p}q~rrrrsststtutuuuuuvwwz{z{||}~~~~~~ïðıŲƲƲƲƲƲƱűűŰįííë§}s|twz~ŸʱŲƴʳɵɴȴɵ&%)&%)&%)&%)'&*('+&(-').&(-').+)/-+1/.2/.2'-,#)( &%%$!$%"%&"%&"%&"$("$("$("$("$("$( %( %(&) '*#(+%*-&*/$(- ,>BNahxov`jr^hp\fnV`hO[cJV^IU]GS[HS^HS^KS`KS`NU^OV_)-,&&&%%%%%&%%&"%&"%&"&%"&%"&%"&%%%&%%&%$(%$(%$(&%)''(&&'('++*.15:<@E;DG>GJ?GN@HOAHQCJSDJVGMYHP]KS`LTaLTaMUbNVcRXeU[hX`m[cp[isWeoScmRblTamTamT`oUap[et`jygmzlrpssvpypylwhs~anz\iuZgsVcoUbnTamU`kU`kV_jT]hS[hRZgTZgSYfZ`mV\i37NKTIMYIMYIPYKR[KT_NWbMWdOYfOYfQ[hT^kV`mZbo]erbhuekxemzgo|eo|eo|eo~dn}dm~eniplssyw}z~~~~}|{{yyx~x~w}v{tyqxpwkvhsfqfqeqdpdpco~dpdpdpdpfreqeqeqeqdpeqeqeqeqepdoepepfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfreqfrgqhrfsfsfsfsfrfrfqfqfrgsfrfrgsfrfrfrgsgsgsgsgsgsgsgsfrgsfrhtesesesftivivhuhuivivkwkwkwlxlymzmzmzmzn{nzo{o{p|q~q~rtuvxxyz{{{||}~~¯¯¯¯°ñıƲdzȵʳʳʳʳʳʳʳʳʵʵʵʵʵȵȴǴǵʴɲɲɲɲɱƱƱưŲųưűưůĮŭİðﯯįĮî®|zxut~s}pzoyjxjxhzhzlylymzmzlymzmzmznzo{o{o{p}q~rrrrrssstttsstuttvvvwxxz{{|}~~~~~~ññűŲƲƲƱűűŰŰůĮí­ª|vtwz|úɳdzǴȵɵʵʷʷ%$(%$(%$(%$(%$('&*$),$),#(+%*-,+/-,0001../,,,&&&$$$####"&$#'%$(%$(%$(%$(%$(%$("$("$("$(#%)"'($)*%*-',/&*/$(-(A@Mdgwpsahq`gp\eiYbfNY]KVZHT\GS[ES]ES]FT^FT^FSY;HN (("$)"$) &% &% &% &%"&%"&%"&%"&%&&&%%%%$(%$(&#''$(%$(%$(&$*)'-019=>F;DH=FJHO?IQ@JRBKVDMXDN[FP]HRaISbLScMTdOVfQXhQ^jTamWeoWeoTamR_kT^mT^mU^oW`qZds`jyel|ipmuowrxrxqxls|eow`jrZdqWanV`mV`mW`kV_jU^iS\gTZgTZgSYfSYfW_fAIP!")&*(%)&$*'%+'&*&%)'&*('+'&*('+(&,)'-$(-%).').&(-+(1+(12/9FCMHKSKNVHPWJRYIS`JTaLVcNXeMZfO\hP]iR_kV`oWap^eubiyblydn{cp|cp|co~bn}bl{cm|gn~lsqyu}z}~~~~}zyxwv~v~x~w}s{qynxnxlujsfqepeqeqdq}dq}dpdpdpdpeqeqeqeqdpdpdpeqfreqeqeqeqeqfrfrfrfrfrfreqfrhrhrhrhrfrfrfrfrfrfrfrfrfrfrhrgqgqgqgphqfrfrfrfrfrfrdrdrdrdrdrdrdrdrfqfqfqfqgsfrgtgtfrfrfrfrfqfqgrfqfqgrhthtgvgvgvhwhviwlxlxlxlxmymymynzm{m{k|k|l~mpqsuwxxzz{{||}~~­¯¯įİűƲȲȳȴɵʴɵʵʵʵʵʵʵʵʵȵȵȴǵȵȴɴɴɴɲɱȲDZưŰŰűƱưŰůİï°ï¯ĮîïįĮî®|zv~t|q{oylylylylylylymzlymzmzkykym{m{lzm{p|p|p|q}ppppqqrsstrsssssssvwxyyzy{{|||~~­ð°°ıŰưưįïůŰİįĭ¯}wq~uxx}õķƵɴȵʵʶ˶%%&%%&%%&$$%%$('&*#()#()&)*'*+++,..///////,,,((($$$$$$##$$$%%$(%$("%&"%&"&%"&%"%&"%&$'($'(#()%*+%--%--&+,&+,# )EBKeftqraip`hoZdkS]dLY_IV\GTZFSYFSYFSYHT\HT\HVX5CE&&''%(%( &% &% &% &% &% &%"%&"%&"&%"&%%%%%%%$$%##$%%&%%&%$('&*.,2>DIJL?KM@LNCKREMTEOWHRZHS^IT_LTaMUbNVcPXeR[fT]hValValU_lS]jS]lU_nX_oY`p]eraivgmzkq~mspvqwqwnwjs~aoy[isXeqUbnTamS`lT_jT_jS^iQ\gPZgPZgRZgT\iRU]8;C"# ((('''''''''&&'''(&&'&&'&&&&&&&&'''(&)*&)*%()%())(,,+/.05=?D@ILDMPGPTIRVKR[OV_NWbPYdOZeQ\gR^fS_gV^kX`m\bo`fsdjwflydn{eo|dn{cmzdlydlyhnzlr~tyx}{~~~|{zxxxvvtr}q{oynxnxjuhsfqfqeqeqer~dq}dpco~dpeqdpdpdpeqdpdpeqeqfreqeqeqepepeqfreqfrfrfrfrfrfsfsfsfsfsfsfsfsfrfrhrhrhrhrhrhrgqgqhrhrfrfrfrfrfrfrdrdrdrdrfrfrfrfrfqfqfrfrfsfsfsfsfrfrfrgsgsfrfrfrgshthuivhuiviviviujvkwlxlylylymzmzn{l{m|m|m|n}o~rrt~vxy||||{{{|~~¯°ñııIJųƴǴǴǵʵʵʵʵʵʵʵʵȵȳȳȳȳȲDZƲDzDzDzDzɱȱȱȱȯưǰǰǮŰŰŰƯůůůįį¯¯¯¯®¬}{xvr~q}mymylylylylymzmzmzmzmzmzmzn{n{n{o|n{p}p}p}q~rrrrrrrrrstusssrtuvwwxxyz|}~~~~~²²IJıŲƱñòƱŰİįî­zq{ruxzƷƳųŴƵǵɴȴ˳$$%%%&%%&%%&"$(#%)#&'%()&*)'+*,,-../001//0)-,$('!%$!%$$$%$$%%%&%%&%%%%%%%%%%%%%%%'''((((((&*)'+*&+,',-&+,%*+!#'BDHfhrpr|^ho^hoUdjO^dJY_FU[ERXERXHRZHRZHRZJT\LT[5=D$),$'"$)"$)"&%"&%"&%"&%"%&"%&"%&"%&"&%"&%#'&"&%$$%$$%$#'%$(%$(&%))+0:IM?JN@JRCMUCNYEP[ER^GT`GT`HUaKUbMWdLYeN[gR_kR_kQ^jQ^jS]lT^mU_nV`o\cscjzemzhp}ksnvqwrxpwls|fmvahqZboX`mV`mT^kS^iR]hP^hN\fL[gL[gMZfP]iCIN-38 )*'''((()&&&'''&&&&&&&&&&&&'''&&&&&&'''%()%()%()%()&)*(+,104:9=CFGILMIPSKRULR^MS_LU`OXcOZeP[fQ\gS^iU]jW_lZ`m_er_gtdlycmzdn{blyblyckxdlyemzjrrxw}y}~~~}yxxwvvu}t|q{pzlylyivgtfreqdocndodocndodpdpco~co~dpdpdoepeqeqeqeqfrfrepepepfqfrfrfrfrfrfrfrfrhrhrfsfsfsfsfsfsfrfrhrhrfsfsfser~frfrfrfrdrdrbtbtbtbtdrdrcqcqepepfqfqfrfrfsfsdsdsdrdrdrdrfqfqfqfqfrgsetfufuetesguftgujvkwlylylylymzmznzo{o|o|p}p}q~q~rstuyyyz{{||}~~¯¯°ðñıIJųƳƴǵȵȵȵȵȵȵȵʵʵʵʲdzȳȲDzDZƲDzDzDzDzɱȱȱȯȯȯƮůƯƮŮŰŰů¯¯¯­­­¬­¬}xvrp}nzmylylylylylymzmzmzmzmzn{n{n{mzn{n{o|o|p}p}p}q~q~q~q~rrrrsttrruttvuvvwwxy{||}}}~~~~±òIJıűűð°ıŮĮĮĭí{s{rvx|~ijŲƲƲȳɳɳɴʴ!$%"%&#&'"%&"$("$("$(#%)$'(%()(*.+-1*/2*/2',- %&!#' "& "& "& #$!$% &% &%#'&$('$)%&+'&*)%)(#()#()%*-%*-%+*$*) %&?DEcipnt{_ip^hoXgmP_eHW]DSYDQWCPVFOZFOZFOZGP[EOW.8@%+0%*!#'"$( &% &% &% &% &% &%!&' %& %& %& &% &% %& %&"%&!$%!$%"%&*,079=7@D;DH8EK:GM>HO>HO?IQBLTDMXENYEO\GQ^IS`IS`LVcLVcMWdNXePZiR\kR\iR\iR\iS]jS]lT^mYcr_ixblyeo|ksmunvowpwls|flx_eqYanW_lT^kR\iP]iN[gN\fM[eKZfKZfLYeP]i@GJ&)"%'*"(&&(&&&&&&&&&&&'''#'&#'&$('#'&#'&%)(#()$)*#()"'(%)(&*),+/548@BFIKOGPSHQTJP\LR^KS`MUbMXcOZeP[fQ\gT]hV_jX`m[cpZgs^kw`my`my_kz]ixahxbiydlyjrsyw}y}~~}|yxwv~v~u}w}v|rzqynxmwivfsfrdpenenenfocncncndododocncndododododoepepepdoepepepfqfqfqepepepgqhrhrhrfrfrfsfsfsfsfrfrfrfrfrfreqeqeqfrfqepaqbrbsbsararcqcqfqepepepepepepepeqfreqfrdrdrdrdrdrdrfrfrdsfucudvcucuctduftguguhviwjxlylylymzn{n{o|o|o|p}q~q~rrstuxxyzz{||}~­¯¯°ñıijƳƴǴǵȵȵȵȵȵʵʴɴɲɳʳʳʳʲɲɲɲɲɴɳȳȳȱȱȱƱưůįƯƱƱưůįįį¯¯¯¬­¬zwrp}n{lylxlxlxlxlymzmzmzmzmzn{mzmzmznzmynznzq{q{p}p}q~p}q~q~rrrrssstssttssstwwxyz{{|}}}}~~îïïññðıŮ®­zr{rvx{|ŲưƱDzȲȳɳɶʶ$#'%$(%$(%$(%$(%$(%$(&%)&&'(()+*..-1*.3*.3$*/!',!&!&" &" &!#("$)&) '*"('$*)$*)$*)%()$'(!&'!&'#)($*)#++$,,%,=CJbhtkq}\io\ioTelL]dFW]@QWAOW@NVDMXENYENYENY?IP(29$)*!&'!#'!#'&&&&&&&& %&!&'!&' %& %(!&)!&) %( %( %(!$%!$%!$%"%&)(,659:<@?AEHP?IQ?IQ@JRDKTELUEOWGQYJS^KT_LTaMUbMUbOWdQYfQYfPZgQ[hR\iS]jS]jT^kZbo^fsekxio|lrououpvltiq~bly[erVcoR_kQ^jO\hN\fN\fN\fLZdLYeLYeQYfV^k>AB'(%()&&&'&&'&&'&&'&&'&&'$'($'($'(#&'#%)%'+$),#(+#(+#(+('+('+,)+524CCCJJJHPPIQQJNZLP\NQ_QTbPVbSYeSYeU[gU[gW]iZ`l[am\dq^fsbjwbjwahx`gw_fv`gwflykq~syx~y}~~}|{yxxv~v~u}w}v|rzpxnxlvhtfreqdpco~co~eo~eo~bn}co~co~dpdpdpdodocndocncndodododododoepepepepgphqhrhrgqhrgqgqipjqhrhrfrfrfrfrfrfrer~er~er~er~eqeqeqeqcqdrbsbscqcqbpdrdrdrcqcqdrcqfrfrfreqdrdrdrdrdrdrdrdrfrfrfsfsfsgtfrgsgshtitititjujvkwlylylymzmynzn{o|o|o|p}p}q~rrstvxxzz{|||¯¯¯°űƲųƴǴǵȵȵȵȵʵʵʴɴɵʵʴɲdzȳȲDzɳʳȳȲDZƳƳƳȳȱȰǰǯƯƯƯƮŮŭį¯¯¯­­­­­¬~zwr~p|mymylxlxlxlxlxlxmzmzmzmzmzmzl{kzlzlznzmyo{nzp}p}q~p}q~q~t~t~t~t~ssssssstssttuvxz{{}}~~~°°°°¯î­¬vn|tvxz|ŷ˵ɳDzȳɳɴʶʶ#( $)"$)"$)"$(#%) '*!(+!(+"),%+0&,1*.3*.3',-!&'!#' "&!#(!#(!%*#',!(+!(+!))"**"+)!*(''''&& ((*(!,*!++!++%.=DMbhujp}^ho\fmTciM\bFT\BPXBMXALWBLYBLYDMXENYBJQ$,3$'("%&$#'%$("%&"%&&&&&&&&&&&&& %&!&' %& %&"%&"%&!%$!%$##$$$%,*05397=D;AH:DLBG;CJ=EL>FM@HOAIPBJQBLSDNUEOVFPWHRZIS[KS`KS`KUbLVcLVcMWdOYhOYhOYhPZiQ[hR\iW_l^fsflxhnzlr~ntououltiq~_lxZgsSbnP_kN]iL[gMZfMZfKXdJWcJWcIVbQZePYd-+1*%.)$-'&*'&*''(&&'$'(%()%()%()%'+%'+&(,%'+%'+%'+%',%',(&,)'-,*0539@EHEJMBMQEPTFOZGP[HR_JTaJWcKXdM[eN\fQ\gQ\gT\iV^kX`m[cp\fs^hu]gt\fs\fu]gvbiygn~rxv||~~}}zyxwv~v~x~w}w}v|rzpxnxlvjthrfpfpfp}fp}fpeo~eo~eo~enendodododoco~co~co~dpdpdpdodododododoeqdpeqfreqeqepdoeqeqfreqeqeqepfqepepeqeqer~dq}gqgqeqeqeqeqeqeqcqcqbsbsbsbsbsardrdrbsbsarbsararcqcqdrcqfrfrbpbpdrdrcqbpdresbrbrcscsdtdtftftguhvkwkwkwlxmymyl{m|m|m|n}n}n|n|rrruwxxyz{||­­­®îïįıƱƲdzƵȵȵȵȵȵʵʵ˴ʴɴɳȳȳȲDZȱȱȲɴɴɳƳƲDZƱưŰŰůįįƮŮŮů¯¯¯­ĭĭĭĬ|yxur~o{mymylylylylylylylylymzlymzmzkzkzj|j|lzkylzkyk|k|k}k}o|o|p}p}q~rrrrrrrsrrrt~t~t~uvxyzzz{}{|}}~~®¬«tlzruxz~Ĺ˳ȳȵʵʶʵɵǵ$)%* '* '* '*!(+!(+!(+!(+#*-',/(-0*/2+03'+0"&+$)!',#--#--#,/"+.$),#(+#%)#%)%%&%%&!#'"$( %( %( %(!&)!(+#*-&/7>G_erfly]gn[elTbjHV^CP\@MYBIYBIYBJWBJWAIVBJWBLT!+3"$("$(#"&"!%$#'%$("%&"%&"&%"&%"%&!$%"$("$(%(%(%(%(!#'!#'$#'%$(++,4458=@>CF;DHGK?HLAIPBJQDLSEMTEOVFPWEQYFRZHR_IS`IS`JTaKUbLVcNXeOYfOYhOYhRZgS[hX^k]cpcivhn{kr{nu~ovovksiq~akz[etSapO]lM[jKYhLXgKWfJVeIUdIUdHTcPYdJS^%"'$.&#-&%)&%)#&'$'("'("'(#(+"'*"'*#(+#()"'($&*$&*%'+%'+$&*%'+)+0249?CHCGLALPDOSCNYEP[ER^GT`IWaJXbKYcM[eN\fO]gU]jV^kW_lYanZdq\fsZfuZfu\fu\fuchxhm}rwv{{~~~{zyyxwwv~w}w}t|t|pznxmwkuishrfp}fp}eo|eo|dn}eo~eo~eo~co~dpco~bn}bm~cncncndododpeqdpeqdpdpdpdpdpdpdpfreqeqepepeqeqeqeqeqdpeqeqeqeqfreqeqeqgqgqfpgqeqeqcqcqdsdsdscr~drdrdrdrbtbtbtas~arbsarbsararcr~cr~er~er~dpeqdrcq`paqbrbrbrbrbsctesesesguguhvixhwkxlylymzkzl{l{m|n}n}n}n}q~rrtwxzzyz{{|}¯°ïİűƱƲDzǴǵȵȵȶɵȵʵʵ˴ʵʴɳʳʳʲɲɲɱȲɴɴɳƴǴdzƲDzDZƲǰůįįĮîí­¯įįįįůůĮï­«««ª~}zxtpm~k|mylxlylylylylylykzkzlylylylymzmzkzkzkykyj{izj{j{l{l{l{l{o|p}q~q~rrrq~rrrrrssrrrtuuvwx{|z{{||~~xpyvx{òƱȱȵʵʵʴɵʵ%(&)&)&)!(+!(+!(+!(+!(+#*-'+0'+0*.3*.3*,0#%) $)#',(-.)./',-%*+#(+ %($'#& #$!$% %& %&%(%($)%*#',%).%'1=?I^bnjnz]hl[fjXcgITXEOWCMUAIV@HU>HU>HU=GT=GT?FO '0"$(!#'#"&#"&$"($"("$("$("%&"%&!#'!#'"$("$(%*$)$)$)$)#($'%(%,/-473>B8CG5DJ5DJ;DOE?IP@MQBOSANZCP\FS_GT`GT`HUaJWcLYeMZfN[gO\hQ^jR_kTamVbqXdsXdsYetYduZev]fwdm~pwszy|~~~~{{{yxwv~v~x~w}u}s{rzpxnvmuishrer~cp|bo{cp|co~co~co~co~co~co~bm~bm~bm~bm~cncncndoco~eqdpeqco~co~dpdpdpeqeqeqeqdpdpeqeqeqfreqeqeqer~er~er~er~frfrfsfsfser~cr~cr~arar`qararbsarardrdrbsbsbsbsararararbsarar`qbpbpao~ao~bpao~bpaobpcqcqcqbsbsbrbrbrcscsdtduevhwixhwjyhzhzhyizizk|k}l~n}n}n}o~rstuwxyyz|||~~­­ĮŮůƮůƲDzDzdzȵȶɴ˳ʳʳʳʳʳʳʵʵʵʴɴɴɴǴDzDZƱƱƱȰDzDzDzDZƲűıİððﯯįįįį¯¯®­««ªª~}{zwsq}nzmylxlxlxlylylylykzjyjyjyjyjykzkzkzkzkykyizj{izizj|j|k}k}k}k}l}l}n}po~po~ppppprrrrnoopvwxyz{xyz{~~zr{twyijĴŶdzɳɳɳɳʳ%(&)&)&) '* '*!(+"),#(+%*-',/).1+03*/2'+0#',%%&''(***,,,***'''&)%(%%$$%#&$'%'%&&&& %("'*%',').'(0ABJadrjm{_gn^fmZbiKSZEOVBLSAKS?IQ?IQ@JR=HS>ITGR>FS?GTBHUDJWDMXENYBPZCQ[DQ]ER^KS`KS`KS`MUbJWcJWcKWfLXgOYfOYfT]hZcnbhtgmykq}lr~lumvksgo|]gtR\iN\kLZiKYhJXgIUdIUdJTcJTcIS`IS`IU]@LT%(&%)&%)%%%&&&"&%#'& &%!'&"'( %&"'("'("'(!&'"'("'("'("'("'*$),&-0.58:DD?II@NPAOQCPVERXGR]IT_IT_JU`IWaLZdMZfMZfPZgQ[hT\iW_lX`mYan\bo]cp]br^csafvhm}rxv|x~|~}}||yyxvw~v}v}v}x~w}s{s{pznxmwkuishrdocncncnbn}co~co~co~co~bn}dn}eo~cncncncndpdpdpdpdpdpdq}dq}cp|dq}fp}fp}fp}gq~fofododoeqeqeqeqeqdper~er~er~er~er~fsdsdsdscr~cqcqarar`paqcqcqcqcqeqfrdscr~cr~cr~cqbpbpbpbpao~co~co~co~bn}bo{cp|cp|cp|bn}bn}cndododocqdrcr~dsdsdsetetetgvhwhwixjyjyjyjykzj|k}k}l~n}n}o~o~rrstvwxyz{||~~ĭĭİǰŰűƱƲdzȳȳȳȴɳȳȳʳʳʳʳʳʵȵȴǴǵȳƳȳȳƳƳƳƳȲDzDzDzȲȲǰűưŰﯯ¯¯¯įį¯®­««ª~}|yvrn}m|jyjyjxjxlylylylylylylxlxlylylylylylymzmzi{i{izizizj{j|i{l{m|m|n}o|p}p}p}q~rrrrrrrrrrrrstvxxxz{z{}~yp{tuw{¸ŴôõǵǴʳɴʵ$'%(&&&&'' ((!(+"),$)*%*+),-*-.,.2,.2),-$'(%%&%%&'''(((&&'%%&"$("$(!$% #$$#%$&$&$$'$' %("'*$(-%).&(2@BL^dqdjw\fm[elWahHRYCPV>KQ=JP=JP?IQ?IQJR##).$&*#%)&&&%%%"&%"&%"&%#'&&&'%%&&&&&&&#'&#'&!*(!*(!*(!*( '*"),&-0/69;EE@JJAMODPREOWEOWHP]IQ^JR_KS`LVcNXeOYhOYhPZiR\kS]jS]jW_lX`mX_oZaq[`p]br`eugl|rxv|x~}}~~}}||{zxv}w~v~v~x~w}t|s{oynxmwkuhrgqfpfpbm~bm~bm~bm~cncnbm~bm~cncndpdpdpdpco~dpdq}er~dq}er~eqco~co~co~fp}gq~gqgqepdododoeqfrer~er~eqdpeqeqeqeqcqcqdrdrdsdscr~cr~`p`p`paqararcr~ap|bpbpdq}cp|bn}bn}bn}bn}_m}_m}_m}_m}al}al}`k|`k|`k|`k|al}`k|^l|^l|_l_lbm~bm~co~dpbq}cr~dsdsdsdsfsgtfugvfxgyhzhzhzhzjyjykym{p}p}p}q~rrr~r~twxxyz{|}~~ĭĮůƯİűƲdzȳȳȳȱʱʱʱʳʳʳ˳˵ʵʶɵȵȴǴdzƳƴdzƲųƳƳȳȳȲDzDzǰȯǯƮůĮîí¯įĭĭĭ­­­¬ª{ywrq~n{lylylylylylylxlxjxjxjxjxjxjxlxlxlylylylykzkzizizi{j|i{i{izj{lzm{m{m{m|m|p}p}qp~p~qqqrrrrrrrtvxxyyyz|yrxu~xrxööŷƳdzǴʴʵǶ "'!#("$(!#' %( %("'(#()%()&)*++,,,-/.2.-1,,-%%&##$$$%%%%%%%##$$$%$$%$$%###"""#"#"#$#$#&#& %("'*%'+%'+$$.==Gadrgjx^gk\eiXaeHQUENRAJN?GN?GN@GP?FO?EQ@FR=CH &+$&!%'"%&#%&#$$%##$#"&$#'$$%##$##$##$##$$$%%$(%$(%%%$$$$$$#####$$$%(*.0265;@9?D8BI9CJ:DL;EMHU!$&)#'&"&%#'&#'&"&%#'&#'&"&%"&%"&%%%%&&&#&'"%&"'("'("'("'(#(+$),'.1/698AD?HK@KOCNRENYENYFN[HP]KQ^MS`LTaNVcMWdOYfN[gO\hO]gQ_iT_jValX`mX`mY`p[br^eudk{owt|z}~~{zzxwwx~x~v|v|u{tzpxpxmwjthrfp}fpeo~cnbm~cnbm~al}bm~am|bn}bo{cp|cp|cp|co~co~co~dpdpdpdpdpco~co~co~co~fpfpfpgqepepepdoeqeqdpeqeqdpdodododoepepdpdpdpdpeqdpbpcqbpao~ap|ap|cp|anzam|am|`k|_j{\hw_kz`l{`l{`l{`l{_m|`n}]n|]n|\m{\m{^l|^l|^l|_m}_m}_m}_m}_m}am|am|anzanzanzanzcp|bo{co~dpdpfrdrdrguhvixixhwixixjylxmynznzo{o{p|p|s}t~suvwxyzz||~ĭĮŮůưDZȱȲɳʳʳʱȱȲɱȳȳȵʵʵʶ˷̵ʵȵȲDzDzDZƱưųȳȴɳȳȲDzDzDzDzǯƯƯƮŭ­¯¯­­­¬Ĭìë««­­«ª~{zvrp}mzlylyjyjyjyjyjyjyhzhzhzhzjxjxlxlxlylylylylxlxkykykzkzjykzizizi{j|i{j|l{l{n{n{o|n{q{q{p}p}q~q~q~q~q~p}q~rtvwxxyyz{|~~yqyu~yvŶ³ĵƵǵǵǵǷƷ"!%#"&##$%%&%%%%%%''((()('+)(,*)--,0/.2/.2)+/#%)"!%"!%! $! $"!%"!% "& "&!% $ $ $! $! $! $#"&%$(&%)('++*.,)3A>H`aolm{]fj]fjXaeGPTCNR>IM=GN=GN=GO=GOG6CI7DJ9CJ;EL>GK@IMAJNCLPBMQCNRCNYDOZEO\EO\HO_IP`LQaMRbKS`LTaMUbMUbNUeOVfRXeY_lbeshkykn|nqmsmsgr}cnyYhtRamL[gHWcIVbHUaISbISbJQaHO_HO_IP`NT`BHT"#&%)&%)!'&!'&!'&!'&!'&!'&"&%"&%"&%$('!&'"'("'*"'*#',"&+#',$(-(-00589AA?GGBKOCLPEMTGOVHNZJP\KQ^LR_MS`OUbOWdQYfMZfN[gQ\gR]hT_jT_jW_lX`mX_oZaq^eudk{qwv|y}~~~}|{{yyxv~x~w}v|v|s{rznxnxjwhufreqbn}bn}bn}bn}bn}bn}bn}bn}bm~bm~bn}bn}co~bn}bn}co~co~dpfpeo~co~co~cndobpbpdoepepepgpfoepepeqeqer~dq}dpco~co~co~dpeqeqdpdpdpdpdpeo~fpcncnbn}`l{anzanzbo{`my`k|`k|^k~]j}[j}]l]m}]m}]m}\l|]n|^o}\m{\m{\m{\m{\m{\m{]n|]n|`n}`n}_m|_m|_nz_nz_nz`o{ap|ap|`o{`o{co~co~bm~al}dpfrgthuhuivhujwkykylylymzo|n{o|p}p}p}p}t~vwxxyyxy{~~¯°ŰŰǰǰűƲɳʱʱʲ˱ʱȱȳȳȵȵȵȶɵȵȳʳʳʲɳʱȱȱȳȴɲɲɱȰǰǰDZɯǯƯƯĮîí¯¯¯¯­¬ë««­­¬~{zvro{lxlxlxlylykxlykxkxjyjyjyixkwkwkwlxlylylylylylylxlxlylylylyjykzkzjyjykzmzmzmzmzoypzp}o|o|o|p}p}p}p}p}q~oppquwxx{||}~{rzu~}y~ŵ´ȴȴȵɵɵɷƶ#$$%"&%"&% %& %&"'*#(+&(-&(-(*/)+0*/2*/2',-!&'$'"% % %$!&"%#&#$"#"%"%"%"%!$"%"$)#%*)'-+)/,)3DAKabphiw[giYegUacFRT@KO?JN;HL:GK9GO9GO9DO;FQ8AD"+.#'&#'&%%&%%&"$(!#'!$%!$%!$%"%&$% %&&&&&'%'%'%&$%%$$##$$$)39>5=J5=J6AL6AL7DJ8EK;FJ=HL?IQ?IQ@KVBMXCMZDN[DN]EO^EN_FO`IP`JQaISbISbISbJTcKUdLVeLXgS_nZgs`myfp}hritiths~bmx\grU`kOYfJTaIS`IS`KRbIP`IPaGN_EO^EO^GR];FQ!%%)"'("'(!'&!'&!'&"('!'&!'& &%!'&!'&"(' ((!))!(+!(+!(+!(+!(+"),$-1,593>B>IM@KOBMQCMUEOWEOWGQYGR]IT_IS`KUbLYeMZfMZfMZfN[gO\hP]iQ^jT^mU_nV`oV`oYcr`jyowrzwz~~~}|{{yx~x~w}w}u{u{sypxpxlyhufser~bn}am|bm~bm~bm~al}bm~bm~bn}bn}bn}bn}bn}bn}co~co~dpdpco~co~co~co~cncncndododoepepepepepepeqdpdpdpdpco~dpdpdpdpar`q`q_p~ao~_m|am|am|`k|`k|_j{^iz^jy`l{_m|_m|]n|]n|Zo~Zo~WqVp~Xo~Xo~[m}Zl|Zl|Zl|Zl|Zl|Zl|Yk{Zl|Yk{[k{\l|\l|\l|Zm{Zm{[n|Zm{[oz]q|\r}]s~]s~]s~]s~]s~\r}\r}_s~`tarbsfrfrfrgsivjwkxlylyn{m|m|m|n}n|o}r~r~stwzz{|}~~~­­ĮůưǰDZȴɵʵʶ˴ɴɳȳȳȳȳʳʵʵʳʳʳʳʳʳʲɲɱȱȳɴʲɲɱưŰǰDzȱǰƱDZưŰðﯰﯮ뫫¬~}zto|nzlxlykxkxjwkwkwiwiwhyhygxhyjxjxlykxkxlyjyjyjyjyjyjyjyjyhzhzg{g{g{fzi{hzjyjymzlylyn{l{m|m|m|m|m|m|n}l~l~ml~o~qttxxyyz{|}~}xp{ptrw÷ȳıȲɳʳʵɵɵɴ "&!#'"&%#'&"&%"&%!%*#',$(-$(-&*/'+0*.3*.3',-"'($'"%"#"#!""##$#$#$"#!%!% $ $!$#& %(!&)%'+&(,#!'?=C`bljlvZeiXcgP]aFSW;KN:JM8HK8HK8FN8FN8FN6DL5@D!,0!'&!'&%%&##$#!'$"(!$%!$%"&%!%$!$% #$"$(!#'&$'%'%&$"%"%#&#&$&+46;6;D8=F6@H8BJ9CJ:DK;FJFMAJMBKNBIRDKTCLWENYGQYHRZKT_KT_LTaMUbNVcPXeQYfQYfQYfQYfRYiU\lV^kX`mT^m\fumwq{w{~~~~}|{zx~v~v~v~u}t|t|u{syqypxivgtfqdodm~dm~dn}cm|cm|cm|dn}dn}dn}dn}dn}eo~co~co~co~co~co~co~co~co~dpdpdocncncncndodpdpdpco~co~co~cndodpdpco~co~bn}bn}co~bn}bo{`my`my_lx^jy^jy]hy[fw\jz_m}_p~`q_s~_s~`s^q\r[q~YpXo~Uo}Uo}Vl~Uk}Uh|Uh|Wi{VhzSgySgyQgyPfxKasOewRgvRgvTixRgvShwUjySjyUl{Qm{Rn|So}Tp~WqXr[q~\r]s^t_u`v_x`y_x]v^t]s^q^qeqgsivlylylymzn{n{o|r|r|s}t~uwz{|~|}~¬¯¯¯įİűƲdzȴǴǵʵʶ̵˵ʵʵʵʳʳʳʳʳʳʳȳȳȳȳʲɴɴɴʴʴɳȱȲɱȰǰȯDZƱƱƱưŰůįį¯¯®îí­­~{ztq}lzjxixixixhwgugujvkwkxkxkxkxkxjwjwkxkxkxkxkxkxlyjyjyhzhzhzhzhzhzjxjxjyjylykxkwkwkwlxlylylymzkzl{l{m|j|k}k}k}o|p}s~utvxxxxy{}~|vp{rsu{ŴDZŲƵɶʷ̵ʸʺ"%&"%&$('$('"('!'&%*%* %.!&/%).'+0*/2).1',-!&'"!%"!%"!% ##!%"%!$!$!$!% $##"%#&#($)"&+%).-08?BJ\_mcft\ei\eiV_bDMP>HO;EL5CK5CK5CK5CK6EK5DJ4=@%("#!$%$$%##$"!%"!%#"&#"&##$$$%#"&"!% "'!& "& "& "& $ %$!%#!'&)*/231=?6BD4DG5EH8EI:GK;HLIM?IP@JQ?KS@LTALWBMXANZBO[CP\CP\EO\EO\FP]GQ^FS_FS_HRaISbLR_RXeadrhkyhoxls|jt|jt|hrzcmuYanS[hIVbER^ER^CP\CP\BO[BO[ANZANZANZCIV8>K##',$&*"$("$("$("$("$("$("$(!'&!'&!'&!'&!&'!&'"'*"'*#(+!&)!%*!%*'+00497?F>IMVaeVcoXeqTguTguQhwSjyTkzUl{Vm|Vm|Xm|Xm|Yk{Zl|`qdufzg{e{e{c{d|byaxcvatbsctfrfrfriumwnxmzo|p}q~rruxy{}~¯¯¯İŰűƲDzDzdzȴɵʵʵʵʵʵʵʵʵʵʵʵȵȵȵȵʵʵȵȴɵʴʳɴɴɱȱȱȱȰǯưǰǰǮŮŮůįĭ­­¬ìì~~}yxto|lxkwkwkwjwivivhuiuiujwkxkxjwjwivgvhwfxgygygyhzgyhzhzjyjyixhwkxkxkwjvgugufwfwfwevfxgyixixkxlylylylymzmzmzn{n{n|n|o}qrtwwwxxy{}~}xr|rty~´ƳŴɴɴɴɴȴȷɹ"&%#'&$('$('$('"&%"$(#%)%'+&(,(*/)+0+-1,.2),-#&'!%!%"#!" $!% $!% $ $ #"""" #"!%%$('&*('+$"(;9?^`lhjv\dk^fmU^bAJN4>E9CJ6FI8HK9IL:JM:HPLV@NX@NXANZANZCP\DQ]DQ]DQ]DQ]BO[CM\DN]EO^FP_GQ`GQ`HO_QXh^dqdjwgmzjp}lr~lr~jp|djvWaiQ[cIT_FQ\BO[ANZBO[ANZCMZCMZCMZBLY?EQ5;G $)'-%"+%"+"$("$("%&"%&"%&#&'#&'#&'"%&"%&"$("$(#%)$&*#%)"$("$(#%)'+015:6>E;DWYegiuclpfosU^aB3<@47E25C28E5;H8ALENYCNY+6A!*5#.'% $# # #! $ ## $!% $ # #" #"$!#"$@>BG?GN2:A%)5". '& # #  ! ! !!" $ $# $ $ $"! $%$(A@DY[`SUZLS\LS\KU]LV^M[eKYcP^hO]gP[fP[fKYcP^hRblWgqWeoVdnSakR`jFUa?NZ;IY;IYBM^AL]AIVCKXEMZLTa[ancivijxlm{mn|mn|hn{ekxXalLU`FRZAMUAKX@JWCKXEMZDQ]FS_AS^AS^=OZ4FQ%"*&*%)$'$'$' %(!#'"$(%$(%$("%&"%& %& %& %& %&$%$%#(!%,=CJ9GOOVAPVCRXDSYETZFT\ES[GT`IVbIVbIVbIVbHUaIS`IS`KS`MUbOUbPVcQWdSYfSYfY_llrv|y}~~|{yyyx~w}w}v|s{s{pznxlyjwgtfsdpbn}al}al}cm|cm|cmzblydlydlydlyemzfn{fn{dn{dn{bn}bn}co~bn}dn}dn}dn}dn}dn}eo~cp|cp|cp|cp|bo{anzbo{anzbn}am|`l{`l{^jy]ix]ix\hw]ix`l{^l{`n}^q^q^q^qao~bpdresatbubuat^s]rXo~Ul{TkzUl{Ul{Ul{QkyPjxNhvMguNetMdsQdrRes=HS !&(-,.3+,4+,4)-2)-2!O\`YfjPdoThsNhuOivOiwOiwPjxPjxQhwPgvKbqH_nXn{cyg}illlllljjffc}b|`z`z`r]oepitkwmyo|p}rrx{|~¯®îðŰůįıȲɵʵʵʶ˵ʵʵʵʵʵʵȵȵȵȵȵȵʴɲɳʰɰɱʰɲɱȱƱƲųƲDzDzDZƱƱƯƮŮí­­­¬««êªª{xrlyjwjwivivgthuhugtgtgthuhuivhuhugthugthuivivivgvhwewewewdvewewgvgvfuetfufufuetetfuetetetetfsgthuhuivjwhzgyhzhzhzhzjyjymzn{p}rsuvxyxz|~ytmzq}tvyijijijdzdzųŴƴƲɲ!%*!%*"'*"'*"'(!&'&) '*!(+"),$*/%+0+-1*,0)-,!%$   !!   ! !""#!#(#%*$&++(1>;DddnooyGPT-.<10C10C31B42C95B>:GHDQTP]\`leiuhkyjm{kn|kn|nr~mq}\bgLRWDHTAEQ>DQ?ER?ERHN[Zbo[cpZgsZgs]kuWeo6=F%,5 ),%($'%($%$%!$%!$%!#'"$( %& %& %& %& %& %&!#'!#''%+.,2IKOacgS]]S]]L]^M^_ScfTdgTdgTdgTagS`fR_eVciVdfVdfT_cQ\`OYaHRZGQ^IS`IS`IS`KUbMWdOYfS]jmsw}~~~~||zx~x~w}w}w}v|tzsyrxowmujriq~gnfm~el}el}dk{el|dlyemzdlydlydlyemzdn{dn{dn}dn}dn{eo|dn{eo|dn}dn}dn}dn}dn}dn}bo{cp|bo{bo{bo{bo{bn}am|co~`l{_kz]ixZfu]ix^jy`l{`myanz^p{`r}`q`qararcqdrdrdrduevevdu`s_rYn}VkzSjyTkzUl{TkzSjyRixPgvOfuPetPetRfqPdo+9A$+18'-4)/6)/6'04%.2!LZbTbjNdqPfsNhvOiwOiwOiwOhyNgxNhvMguHbpHbpYo|bxf|illllllllllm~m~j}i|h{fybt_qasdvhyj{o{q}t~wz{{|}~©­®îîůƯưdzʳʵʵʶ˵ʵȵȵȵȵʵʵʵʵʵʵʵʴǵȳȲDZȱȱʰɱȱȱȱȳȳȳȲDZƱƲDZưððﯯ¯ĭ­­­¬~zyrlykxivhuhuhuhugtgtgtgthuhufveuetetetethuhufufuduevdvewdvdvdvcuesftesesfufuetdsdsdsesdrdrdrdresesesctduewfxgyhzhzhzjyjyjyjyo|q~stuwxxz}|~}}yp~kyl}qsx³ijijdzdzųųdzǶ˵"$(#%)#&'#&'"&%"&%"%&#&''&*('+*)-,+/--.--.+++$$$ !"! #!%%#)'%+/+1:623;&*6%)5)+0').')-&(,'&*%$(("'%$'#)%"&!%%%##""""  ! ! ! % %&%%% '!($%$%($%'##! "!''"1(#2)$3,'6-(7*%40&80&88+>8+>5(;4':4(88,<;7DMIV[]gegqhjvjlxlp|osot}joxUY^;?D/1646;89A56>85>@=FFEREDQ?GT?GT@HUAIV57C(*6&$*%#)!#'!#' $#!%$"&%"&%"%&"%&"%&"%&"%&"%&"%& #$#"&$#'&$*206FEIPOSKMRMOTIQXIQXMU\NV]NV]PX_OW^QY`PV]RX_RX]SY^TX]OSXHNUAGN?IQ?IQ?GTAIVBHTEKWNO]RSarq~}~||z~z~w}w}v|v|u{u{syrxqwoujrhp}gnel}el}el}dk{dk{dk{dk{fk{fk{fk{fk{dk{el|el|el|dn}dn}eo~dn}cm|cm|dn}cm|cm|cm|dn}cm|am|co~am|am|`l{`l{^iz[fw^hw_ixakxakx`my`my`mybo{bq}bq}bpcqcqcqfqfqdresevfwdwbu`r]oXm|VkzUjyUjyVlyVlyTjwTjwRhuRhuQfuQfuQgtOer-@G"#04#04'03(14)03)03 #*R_kXeqNdqQgtPgvQhwPgvQhwPgvPgvPfxNdvI`oKbqZo~bwj}k~llnnlmnllllllk~k~i|gzfydwbuduevmynzs}uxzz{|~ìíĭįįıƲDZƳȳȴɴǵȵȵȵȵȵȵȳʳʳʳʳʳʵȵȳȲdzȳȳȳȳȲDzɱȱȱȱɱɱɰȲDZƲDZưŰůįįįįĭ¬īë««ª~~}|xvqiwjwjwhuivhugthrhrhrhrfsfsfsfsft~ft~ft~ft~fsfsgtfscudvdvdvdvdvfsfsfrfrfsfsdsdsdsdsdsdsdsdsdrdrdsdsfsfsfsfsgthuivjwkxkxkylzlzlzm{o}s}t~uxyzz|~~~wpm|prr{³²ųųdzdzdzǵʳ%%&%%&%%%'''&&&%%%%%&%%&&&'(()**+--.//////(-)"'#  !!! $$#'%$(+(*0-/605605/(/6/60.4.,2',-$)*"** ((%(#& $ $!% "& #"! """"   !! # ###"# & & &!'!' &!%!%$$%%&(&('"+(#,&(-(*/*,1,.3,-5,-5--7,,6,-5,-5+-7*,6+-7+-7,.8+-7#)07=DW]dagnegqjlvns|w|oyyV``9DB +)"&$-1/08-.63,55.76+21&-!*(. 1%$2#"0$!*"(#"&$#'!%$!%$"&%"&%"%&"%&"&%!%$"%&!$%!#'!%#"&$#'%$()(,,*0,*0/*3/*3.,2206,*0-+1.05.05'*2'*2-2;05>15A15A03A.1?-.<23A:7A63=/.;65B48D/3?9;EQS]pr|{}z~}}|{yx~w}w}v|w}v|tzsyrxpvntjrgo|fm}fm}dk{dk{dlyemzdlydlydlydlydk{dk{dk{fm}cm|dn}bn}am|bn}am|al}bm~bm~bm~bn}am|anzanz`myanzbl{bl{akz`jy^hw\fu[ht^kw`myanzanzanzbo{cp|er~er~er~er~eqfrdresdvewewfxcwbv^s\qVm|TkzRhzQgySjySjySjyRixPgvPgvNhvNhvLhvHdr4OY %/#**1%04&15'04 )-#,8@L_mQdrMdsPgvPgvQhwPgvPgvPgvPgvNgxIbsD]nKdu]sdzj~kllnooooopoponnllli|e{dz_u_ufwhyo{r~uxz||}~~¯¯İűƱƲŲųƴǴǵȵȵȵʵʵʵʵʵʵʵʵʵʵʵʳʳʳȳȳȲǴǴǴɳȴɳȳɲȲȲȱƲDzǰŰŰŰůįįįĮí­­­®ì~~}|{{yxvp~iwivhugthufsfshrhrhrhrfsfsfsfsfser~es}ft~fsfsfsfsfsfsfsfsfsfsfsfsfsfsfrfrfsfsfsfsfsfsdsdsdsdsdsdsdsdser~er~frfrgthuivjwjxkylzlzlzm{s|t}vxvwx{}~xro}p~qryųı³Ųijdzdzdzǵȵ %& %&$('$('#'&"&%"%&"%&&%)('++*.-,0111000,.)$&!    #!%#!'%#))'-,)20-60.4/-3+-2*,1"+.(+%(#&!$ #!$#&#$"# ! !"!!  ! !""""##$$ $ $! $"!% $# $# $# $#"&%"&%$('&*)$,,&..'//'//'.1'.1'-2'-2'-2&,1&,3&,3',5',5(-6).7!)47?WZbbemhkynqjp}^dqDJV$*6&*(15)-9*.:+/4*.3+/4*.3-*3)&/(#,$.$.$.",!'!'#"&#"&!$% #$!$%"# "&!#'!$%!$%$$%##$"!%"!%#"&#"&$#'%$(%",&%'%#)1/5-*=-*=+'>-)@/->0.?10=0/23A./=#$2)FFPrr|xxz~{~~}~}|~|~x{y|w}w}u{tzsyrxpvmslrkq~hn{gmzgl|fk{dk{dk{emzemzdlydlybl{bl{cm|cm|cm|cm|bn}am|al}al}al}bm~`n}`n}`n}_m|am|`l{`l{`l{_kz^jy\hw[gv]gt^hu^kw`myanzbo{bo{bo{bo{cp|fp}hrfser~fsfsbsbsctduguguguftesbp[n|UhvNetQhwSjySjyUjyTixSivRhuPhuPhuNhvKesA[i)CQ & )6:ERVN_mQbpNfsPhuNhuOivMguLftKesGaoH`s4L_=UhUmeyi}kllmonqrqrppppqqrqlllj~f|dz^tawdxfzm~pux{|~~~­­®îïİŰűƳȴɵʴɵʵʵʵʵ˵˵ʵʵʵʵʵʵʵʵʵʵʴɴɴɵʴɴʴʳɲȲȳɳȲDzDzDZưŰŰŰůį¯¯¯®~}}{zwq{kukuisishrhrhrhrgqer~fsfser~er~dq}dq}dq}cr~cr~cr~cr~frfrfreqdpdper~fsfsfsdsdsdrcqcqbpcr~cr~cr~cr~btas~as~btdsbq}cqbpdpeqeqfrfsfshuhujxjxjyl{kylzmzo|qstvxy|}|~~~~zr}nyo}ruy~ƴŲòijųųųųŵŹ!&)!&)!&'#()!'& &% &% &%'''(((-++0..22-22-+++%%%!  !"""$$$&&&***,,,-,0-,0)+/')-#%) "&$$!$"%&&&&&&$$!$ #""    """# !"#"#!$%&$'%'%'%'%'%(&)'"+)$-+%.,%.,',/(-0(-0).1)-2(,1(,1(,1(,1(,1)-2*.3+03,14*)-<;?a_erpvqrzkltU^i:CN$.;&0=-5<*29+16)/4'03&/2).1',/('+%$('$&'$&%%&%%&$$%""# !!!"""###$"""###!!" !! $! $##$##$########$##$$$%##$###"""$!%&#'($$)%%)%#)%#+$%+$%+$&+$&*&&.**1--3//302413215215215215/16/1602735:57<57<"#+56>mn|vw~~}|{zzz~z~w}v|v|v|u{u{syrxoumsjriq~fn{emzdk{dk{flyflydlyemzdk{dk{dk{dk{dk|dk|bk|cl}al}`k|al}al}al}al}am|am|am|am|`my`my_lx_lx^kw]jv\iu]jv^kw_lx`myanzanzbo{bo{bo{bo{dq}er~fsfreqeqfrdsetetfufugvguftctct[rTkzKguRn|Rn|Rn|Rn|Qm{PlzNjxNkwOlxMjvMjvHdrC+0938Ahkytwz{~~~~}}{{yxx~x~w}v|v|v|u{syrxrxqwntlrjp}hn{gmzdlydlydlyemzdlydlydk{dk{dk{dk{dk|dk|bk|bk|bk|bk|bl{cm|cmzcmzam|am|`l{`l{`l{^jy]ix]ix\hw\hw[jv\kw]lx^myanzanzbo{bo{bo{bo{cp|cp|eqfreqfrdrdrbsbsctdudududuevduevcvatXuXuXuXuXs}Xs}\r}[q|Zp{Zp{[oz[ozZl|TfvPbrOaqK_jH\gL^aWil_nt`ou^p{as~^t^t`v`v_uawdzg}h|ollollmooonqqrrrrrrrtrroonmlnkh~dycxhyj{q~uz||}~¯¯°ñIJDzDZȱȳʳʳʳʵȵȵʵʵʵʳʴ˴ɴɴɴɳȳȵʴɴɵʴʵ˴ʴʲʲʱȱȱƱƱưŲŲűƯİůĮîí­­­¬ì뫪ªªª|{xrn{kxhugtfrfrgq~gq~er~er~er~er~dq}dq}co~bn}co~co~eqco~cp|dq}er~cp|cp|dq}cp|cp|cp|cp|dq}cp|cp|er~dq}bo{co~co~bo{bo{cp|cp|cp|cp|br|cs}bszct{drzdrzcp|cp|co~co~dpdpdq}er~dsetewgygyhzhzhzmzp}rruwx|}~|tlzlzn|qqxóűòijųŲijųŴƵ"&%"&%$('%)("('!'& &% &%#%)$&*))*++,------,,,%%%  !"!" #" % "'"%*&',(%+*#)( %&"#!" !#$ %& &% &% &% &%"&%!%$!!!      !"    !!"""###$!$%!$%%(&) '* '*"+)"+)$*)#)(#(+$),')-(*.').').&(-&(-)'-(&,').)+0'+0'+0)-2,05/169;@GIUBDP*2?%-:'.7)0913=02<00://9-.6,-5*,0')-"$("$(%%&''(#)("('#)("('"&% $# ! !!!"!!"! $ #!"!" #"! $"!%""""""###""""""######$$$%%%%%%&&'&&''''((($'($'($),&+.%,/&-0'.1(/2*/2+03,14-25-25.36/4705818;4;>7=B:@E.3<5:Cgjxtwzz}~}|yx~x~x~v|v|u{u{vztxrxrxqwntlrjp}hn{flyflyflyflyflyfk{fk{fk{fk{flyflydlydlydk{dk{cjzdk{dlyemzdlydlybl{bl{`l{_kz_j{]hy]fw]fw_ix`jy]lx^my^my^myanzanzanzanzbn}bn}co~dpcqbpdrdrcqdrdrdrdresctdududududufwfwb{b{]z]z`y`ycydzezdyh{gzk|k|j|nqoo~pn}n}p~m{j{nli}g{j~l~l~k~lmmkkklonqpprrrrrpqrrqqrroonnomki}eydxkzo~vxz|}~­ĭĮŮŰǰDZȲɲɳʳʳʵʵʵȵȳȳȴɳȳȴɳȴɳȳȴɵʵʵʵʴɴɴɲɲɱȱȱƱƱƱƲűıİðððﯯ­¬Ĭ몭¬~}ytozkvgtfser~er~dq}er~dq}dq}dq}cp|dq}bo{cp|cp|bo{bo{cp|cp|dq}cp|dq}cp|cp|cp|cp|cp|co~co~cp|cp|cp|cp|cp|anzbo{bo{bo{bo{bo{bo{cq{cq{cqycqycqycqycq{cq{bo{bo{bo{bo{cp|bo{bo{cp|dq}fsetfugvhwhwixjyl{p~rqtvx{}~}~~~ul{kzm{p~r|´ųIJijųųųųŴƳ"%&#&'''''''$('"&%"%&"%&%%&''()))+++,,,...(,+"&%!!"#  $#!%$"&%$('%)( ((&&$'#&#&$'%(%(!&' %& &%!'&"&%"&% $"!!  !"!"   !!!"""$$$!%$"&%(&(&!(+"),"+)"+)#)(#)($),$),%*-&+.%*-%*-%'+$&*%$(&%)'&**)-+)/,*0/-31/521576:;:>+*.# *30:437548437326-16,05,14',/&)*"%&$$$&&&%)(%)(#)(#)(#(+"'*"%&!"""!!"""#" !!"!""" #! $""""""!!! !!!""""""###%%%&&&&&&&&&''(''('&*)(,')-)+/)+0)+0+-1+-1,/0,/0-01/23/15/1521554876:<;?=?DACH35?;=Ghguwv~~}}|z~z~x~x~w}v|u{u{syrxpxpxowksjrgo|emzdlyflyflyflyflyflyflyfk{fk{flyflydlydlydlydlyckxckxdk{dk{dlydlydlydlycjzahx_fv^eu_fvahxaivckx`my`my`my`myanzanzcmzcmzanzbo{dq}dq}cqcqcqdrdrdrdrdreseseseseseseseseugwdzdzdzdzdzdzbzc{b|a{d~c}ghh{j}orqqli|h~id~efff~hijjjjkmmmnppporrrsrsqqqqrrrsrrqqnnljfb{gxgxt~v|¬ĭĮŮůưǴɳȴɵʵʵʵʵʵʵʵʵʳʳʳʳʳʳʵʵʵʵʵʵʵʵʴɳȳȳȳȲDzųƲŲŲűıưŰŰůįĭĭĭĭĬìë«««ª}}|zxs}lyhufsfsdq}dq}dq}dq}cp|cp|cp|cp|co~bn}anzanzanzanzbo{bo{cp|cp|bo{bo{bo{bo{cp|cp|bo{bo{cp|bo{dn{dn{dn{cmzcmzcmzdn{cmzcmzcmzemzfn{fozenydozdozbpzbpzanz`myanzbo{anzbo{bpzcq{cqydrzes{es{ft~hviwjxlwnyo{r~rtwz|~~wpzoyr{t}t}±ñòIJijųŴƴƳų"$("$(%%&''(%%&%%&#"&$#'%$('&*&)*'*+),-),-++,##$   !""## "&$$%%%&'&*('+"&+"&+&)&)'&('''''&)%(''&& &%%$"# ! ! !!!!""""    """######"%&"%&&) '*"),!(+"**"**$)*$)*$),%*-',/&+.(*.&(,&%)$#'#!'#!'#%*&(-)+/*,0)-2*.3*05+16,29-3:/2:/2:/38/38.49,27+25+25(-0%*-"$(!#'"%&%()$*)$*)#(+#(+%'+#%)%#)!% # #  ! ! !"!"""" #!!"""#!!" !!!"!!"! $"!%$#'&%)&&&''''&*'&*)(,*)-,+/,+/)+/)+/'+0(,1)-2*.3+/4,05,05-16/1613874=<9B?AKBDN7;G7;Gfguwx~~~~||yx~x~x~w}w}wzwzuxtwtwtwpvmsjp}hn{gl|fk{fj|ei{fk{fk{ekxekxejzfk{flyflyflyflydlyckxdk{cjzdlydlyckxckxcjzahxafv`eu`dv`dv_fvahxakxakx`my_lx`my`my`l{`l{`l{am|am|bn}co~frcqdrdrdrdrdrdsfuetetctctctdudteufwhyhyhyhyhyhyhyizizgzgzh{h{h|g{hyhyj{j{i|i|i|i|j}j}j}j}l}m~k~k~lk~l~l~nnmllnnmnnoonoooqqqrrsssuttsssrqojezbwfxk}ux{}~­ĭĮůưǰdzȴɵʵʵʵʵʵʵʵʳʳʳʳʳʳʵʵʵʵʵʵʵʵʵʴɵʴɴɳȲDzDzDzDzDZƱƱƱưűǰưůĭĬìíĬë¬ë«««~|zvlyhudsdscr~bq}ap|ap|cp|cp|cp|bo{bn}bn}am|`l{anzanzbo{bo{bo{anzanzanzanzbo{bo{anzam|am|bo{bo{bo{bo{anz`myanzanzanz`my`l{`l{`l{`l{`myanzanzanz`my`my_nz^my_m|_m|^l{_m|aoyaoyaoyaoybo{bo{er~fshuhujwkxlzn|qruxz|~~wr|q{ozq|l}v°İıŲƳųųųųdz$!*%"+%$(&%)'$(&#'#!'$"(%$(&%)('+('++*.,+/)(,$#'  !"!!!"""##!%#!'%#)&$*(&,#',#',(,(,(,'+'*&) '*&)&)&)!'& &% &%$# ! !      ####""""" #!!"""###$$$%%$(%$(!&)"'*#(+#(+#(+$),$),%*-%*-&+.&*/%).%'+$&*$#'"!%""!%%$(*)-',-(-.(/2(/2)/4)/4-25.36.36/47058058/47/47.27+/4',/#(+ %&!&'"+)#,*#++"**$),$),&(,%'+%$(#"& # #""    !"!"!#!# $ $ #! $##!% "&"$("$($('$('&&&(((*)-+*.+)/,*0+)/,*0)+0*,1)-2*.3*.3+/4,05-1602713874>>;EABJEFN68B8:Dijxvwx{{~~~~|{xxx~x~w}u{u{tzuxuxrxqwoulrjogl|fj|ei{ei{ei{ejzejzejzejzejzfk{ekxflyekxekxekxflydlydlydlyckxbiybiycgybfx`dv`dv^eu_fv_ix`jy_kz_kz`my`my_lx_lx`l{am|`k|bm~co~co~bpcqbsbsbsbsbsbsbsctesdresftbvcwdwdwewfxhxhxhyhyjxjxjxkyizj{j{j{izj{izizj{k|k|k|l}l}k}k}k~llk~m~m~m}m}m}m}nommllmmoooppppqppstrrsssstuuussmlhe}exdwm{ty{}~¬íĭĮŮŰDzDzDzɲɳʳʳʳʳʴ˴˴˳ʳʳʳʳʳʳʳʵʶ˵ʵʵʵʵʵʴɳȳɲȲȲȱƲDZƲDzDZƱDZDZǰƮůƮŬììììë«««««ª~||u}lyfsdsdsbq}bq}cp|cp|cp|cp|bo{bo{bo{anz`myanzanzanzanzanzanzanzanzanzanzanzcmzblyblycmzcmzcmzanz`myanz`my`my`my`my`my`my`my`my_lx_lx`my`my`my_lx`my^my^my^my^my`my`my`my_lxalwbmxbmxbmxcq{dr|ft~ft~hviwmxnyq}sux|~~wryryqzs|q|ôŲòijųųųųųdz!!+"",%$(%$(%$($#'"!%#"&$"(%#)%#)(&,+)/,*0)'-$"(  """#### % %#"&$#'%$('&*$&*#%)#(+#(+!(+!(+!(+!(+))))))))!*((& &%%$!" ! # #" #! $ ####!%""" #! $! $ # #$!%&#'%%&%%&"%&#&'"'*"'*#',#',$(-$(-%*-%*-$)*#()"$( "& #" ""#%%&))*)+/)+/'.1(/2(.3*05+16+16.27.27027027138027-16*.3$+."), ), ),"+."+.$*/#).%).%).')-&(,#%)!#'"!% # !!!"!!" !""""## $ $!%!% %!& "&!#'"%&#&'$'(#&'$&*&(,')-)+/)+0)+0)+0(*/)*2*+3(-0*/2+03,14-25.3613824954A;:GAAKDDN35A57Cijxuvwzz}|}~}}{z~y}y}y|x{wzvyvyvytzsyrxrxmvkthp}fn{dk{biydhzei{ejzejzgjzgjzekxdjwekxekxekxekxdjwekxflyflyekxdjwchxbgwafv_dt^cs`eu`huaiv_iv`jw^jy^jy_kz_kz`l{`l{`k|`k|_m}`n~aocqcqcqbrbr`r`r`r`rbrcscscsctdubudwexexfxfxhxhxhxgwjxjxjxjxkykyiyiyj{j{j{j{j{k|k{l|l|m}k}l~lllllk~k}l~n~n~nnmlllllnooooqpprrssrrrqtuuuuustqrrmi~avaqk{w{ïįįıưűƳȴɴɳʳʳʳʳʳʴ˳ʳʳʳ˳˵˵˵ʵʵʶ˵ʵʳʳʳʳʲɱȳȳȳɳɲȲȲȲȰȯǯƯƯƮŭĮŮŭĭĬìë«~~~|{t}nxfp}fsdq}bq}ap|bo{bo{bo{bo{`my`my`my`my`my`my`my`my`my`my`my`my`my`my`my`my`my`my`my`my`my`myblybly`my`my`my`my`my_lxblyakxakx`jw^kw_lx_lx_lx^kw_lx_lx_lx_lx_lx`my^kw^kw^kw`jwakx`my`myanzbo{cp|er~js~ktmwnxpzr|u~x|~|t~pzpzo|rqx|ŴŲòIJijdzDzȱdzʵ$)$) %(!&) %($'$'!$ % "'"$)$&++*.,+/))*##$  ""##### $ $!'!'"!%$#'%$(%$(%$(&%)!(+ '*'*(+"&+#',#(+$),#()#()#()#()#'&"&%!%$ $# #$!" $# $#$$$$$$##$""#""#""#"""""""""""""""!!!# ""!$!%%"&$#'%$("$(#%)"&+"&+#',#',$),$),%*-#(+"'* %(!&$"" ###%%&(()(*/)+0&,1'-2&/3'04*05+16-16-16-16.27.27-16(15$-1"+/"+/"+/"+/$*/%+0&*/&*/(*.)+/(+,&)*$'("%&!%$ $#$#$#$#$##"#"#""!"""!!!!!" !!%!%!&"'#(#("$)#%*#%*%',$),&+.&+,',-'+0&*/%+2%+2&,3'-4(/2'.1+03-25-25.3612:34<65B;:G@AOBCQ69G=@Nfiwpswyxz{}|~~~|~|~|~|~{}|~{}z|y{xzwxxyuyuyszryoumskq~hn{fk{diyejzdiyei{ei{ejzejzdjwdjwdjwekxekxekxdjwdjwdiyejzdiychxafvafv^ev^ev^eu`gw^hw_ix`jy`jy^jy^jy_kz`l{]kz^l{^l{_m|bm~cnbpcqbsbsbsbsbsctbsbsbsctcscsduduevfwdwexfxfxfxfxewewhyhyhyizizizgzh{h{i|j{k|k|l}l}l}k~k~llllnnnnnnnnnoonnnnnn~n~n~ooppprrsttttttuuuuutttttsqndu]n|myx{}ìíĭĭİŰŲdzȱȳʴ˳ʳ˳˳ʴ˵ʶ˶˶˵ʵʵ˵˵ʵʵȶɵȵȵʵʵʴɴʳɱȱȱȱȰǰDzDzDzDzǯƯƯƯƯĮí­®~|t}mwfp}dpdpcp|cp|dozdozcnycnycmzblyblyblyakxakxakxbly`my`my`my`my`my`my`my_lxakxblyakxblybly`jw`jyakz`my`my`my`my`my^kw^jy^jy_lx^kw^kw^kw^kw^kw^jy^jy]jv^kw_lx^kw]jv^kw^kw^kw^kw^kw^kw_lx`my`my`my`mycp|fshs~itlwnyq{t~wzy}~~~}v~lv}oyl{pg{qŰóijųŴȴȵɹ#( $) %(!&) %& %&!" ! #! $#"&&%)*)-,+/&(,"$( "###### $ $!%!%"!%#"&"!%$#'%%&$$% %& %& %( %(%#)%#)%$(%$(%$(%$(%$(%$("&%!%$!$% #$ #$ #$!%$"&%"&%"&%$$$$$$$$$$$$$$$$$$ $# $#!%$!%$ $##"##$$$%"&%"&% &% &%!'&!'&"'("'(%()%()$'("%&$#'"!%! $ #   ""#%$('&*)(,,+/'+0'+0)-2*.3-/4.05-/3/15/15/15+25+25%04#.2"-1!,0!,0!,0#,0#,0#,0#,0%,/%,/$,,#++!(+ '*'%'%(#'"&$%#%$%$ $#"!"""!!!!!!""" $ $#&$'$'$'%$(%$(''(''(&)*'*+'*+'*+(*.(*.'+0'+0&,1(.3(.3(.3+03-2522322354887;<:@@>DC@IFCL35?<>Hcgsnr~vxwy|{~}}~|z}z~z~zz{}{}{}z|xzwyuxvyuxuxrxqwntmskq~gmzflyekxekxdjwdjwekxejzejzdjwdjwdjwdjwdjwdjwdjwdjwdiydiybgwafv`eu_dt^eu^eu\fs^hu]ix]ix^jy_kz_j{^iz\jy\jy^l{^l{]n|^o}_o`pbraq`s`s`s`s`s`sbsbsatbubtcucvdwdwexexfyfyfyfyfyewfxfyfyhyj{gzh{gzi|i}i}h|i}k|l}n|o}m~m~nnnnnnnnnnp~p~p~qnnnnnnn~n~noopppppsttttsttwwwwvvttrrpok^v[n|j}uzĭĭĭįıưDZȲɲɳʳʳʴ˳ȴɴɴɶɵȵʵʵʵʵʵʵʵʳʳʳʲɴɳȳȳȴɴɲɱȱȱȰǰDZȰǯƯƭƭƮŬëīĭĬê«««~}}|vmzjvfrdpco~bo{bo{cmzcmzenydmxdlydlyakxakx`jw`jwblyakx`my`my`my`my`my_lx_lx_lxbjwbjwckxckxakx`jw`jw`jw^kw_lx_lx_lx^kw]jv`jw`jw_iv_ivajuaju^hu_iv]ix]ix]jv]jv]ku]ku^hu_iv_iv`jw_iv_iv_iv_ivakx`jwakxblyblyeo|is{jt|ivzkx|m|ptux{}~~~}ryjt|nxnzp|p{Ʊ¯³³ŴƴȴȳǴ "'!#("$("$(#'&"&%!" """ &%#)**+--.%+*%$!" # #$# $ $$ % % % %!&!%#!'#!'#!' "' "'!"* !)#!'" &#!'" &" &" &#!'$"($#'"!%"!%"!%!%!%#"&$#'$$$$$$$$$$$$##$##$##$$$%!%$!%$!%$!%$!$%!$%!%$!%$ &% &% &% &% %& %&"%&"%&&%)&%)%$($#'#"& #"""""! $%$(&%)'%+*(.+)/+)/,+/,+/-,0-,0--.../../../.,2-+1(,1'+0#,/#,/#--#--#--#--#--#--%--$,,%*+%*+%*+#()"('!'& '# '#%&#%&#%%%$$$$$$$$$$$$"""######$'$'$'$'$'$'%%&%%&&&&'''((()))***)))*)-*)-')-(*.%,/'.1'.1(/2,12-23/3204346:68<:DACHBDI9:B<=Eedqrq~vvxxy{{}|~|~|~|~zzy~y~y{z|y{xzwyvxtxtxtxtxtytyqvot}np|lnzjkyijxijxijxhiwijxkjxkjxihvihvghvhiwekxdjwdjwcivbhuagt`fs_er^cs_dt`euafv^hw^hw\hw\hw]hy]hyZky[lz\ny\ny^p{_q|`q`qaqaqbsbsbsbsbsbsctctatbudvdvexexfyexfyfyfyfyfxfxfyfyfygzh{h{h|h|h|i}i|i|j}j}j}j}n|n|o}p~llllllnnnnn~n~n~n~m~nnnllllnnp~qqqnmnnooopttvvvvwxxxvvuvsttslexgsmyz­ĮůƯưűƳȳȲdzȴɳȴɴɵ̵̴˳ʵʵʶ˶˵˵˵˵˴ʴʵʴɳȳȴɳȳȳȲDzDzȲȲȱDzDZƯƯưǯƮŭĭĭĭĭĬ~}|{xpxnviq~eo|cmzcmzblyblyblyakx`jw^kw^kw]jv]jv]jv]jv]jv]jv^kw^kw`jw`jw^kw_lx_lx^kw]jv]jv]jv^kw_iv_iv\iu]jv\iu]jv^kw]jv]jv\iu\iu\iu\iu\iu\iu[ht]gt]gt[ht[ht\iu\iu[ht[ht]gt]gt\fs\fs\fs^hu]hs^it]hs^it^hu^hu^hu`jwblycmzeqygs{jt|lv~s}vuxz}~~~~ynwfozmvoypzr}ŴƳųdzǴȴȴȴȴȸ!$%"%&"%&#&'#%)"$(!% $"""#'$(**+,,-%*- %(   !!$"%#&$'%&&&&%(%(%(%(%($'&$'%&&&&%(%(%(%($'%(%($'$'$' %& %&'%'%&&&& %& %&$'$' %($'&&&&&&%%%%%%$'$' %( %("$(!#'"$("$( %($'%(%(%(%(%(%( %& %&!'&!'&#$!" !!!"! $! $"" #! $!!"""#$#'%$(%$(%$(%%&%%&'$&'$&)$&)$&)#()#()#()#((%)'$('$('$('$&'$&&&&&&&&&&%%%'$('$('$('$(%$(&%)&%)%$(%%&%%&%%%%%%&&&&&&%%&%%&"$("$( %(!&)&)%(&)%(&)&)"$("$(%%&%%&''''''''''''&&'''(&&'&&'''())*)(,*)-,,-//03337777;:8<;:<@>@DCAGECI56>67?bcqmn|wyxzy}{|||~|~{}z|z|z|y{xzxzwywyvxvxvxvxvxvxuwsuqsno}lm{jkyijxjiwjiwjiwkjxjiwjiwjiwjiwghvhiwfiwfiwdjwcivagt`fs`cs`cs`csadt`dvbfx`gx`gx]ix]ixZkyZkyZky\m{[n|]p~^q^q_r^q_r_r`s`sbsbsbsctatbubudwewewexfyfyfyfyfyfxfxezezezdyezf{i{i{hzi{i|j}j}j}k~k~k~k~l}m~m~nm~m~m~nlmmllll~l~lllllk~lk~j}k~o}p~p~p~ooopnoooopssttvvwxxxvvuuttrqnkZtQkyqw~¯¯İűƳȳƴdzȳȳʳʲǴɴ˴˵̵̴˳ʳʳʶɵȴɳȳʳʳ˳˳˳˱ɱɳȴɱȰǰǰǰȰȲȲȱȱȰůįįĮŭĭ­­¬~}xvtlykufp}eo|cmzblybly_lx_lx_lx]jv]jv]jv]jv]jv]jv\iu]jv\iu]jv^kw^kw^kw^kw^kw^kw^kw]jv]jv^kw^kw^kw]jv]jv\iu[ix[ix[jv[jv\iu\iu\iu[ht\iu[ht[ht[ht[ht\iu[ht[ht[ht[htZgs[ht]gt\fs\fs\fs\fs\fs^fs^fs^fs^fs^hp_iq_iq`jrajuclwfmvhoxipymt}pzs}wz|}~~~~xiu}cowjv~oypzq~|ƸɳijųŴƴƴȴȶʸ$#'$#'"$(#%)#%)"$(#"& #""# $'$(***---)-,!%$ !" %#!&!"'""'#"'#"&%"&%"$("$("$(#%)"%&"%&#'&"&%!'&!'& (( (('' ((!'&!'& &% &%"%&"%& %& %&(&'%(&(&''&& %& %& &% &%"%&#&' %& %&'%'%(&'%(&(&''&&&&&& &% &%&&&&%(%(&&&&!'&"('%)($('%%&""#! $"!%""#!!" #"" #! $"!%$#'$#'%$(%$("%&"%&"%&"%&%%&%%&%$(%$(%$(%$(%$(&%)%%&%%&%%&%%&%%%&&&%%%%%%"$("$( %( %( %&!&'!&' %&"%&"%&%%%%%%&&&&&&&&&%%%&%)&%)%$(%$("$(#%)#%)"$("$)"$)#%)"$(#'&#'&#'&#'&"&%#'&#&'#&'#&'#&'$'(%()%'+%'+(*.+-1/453894<<5==9=B;?D?BJ@CK8:D46@acolnzuuwwwyz|y~y~y}y}x|x|xzxzxzwywywyvxvxvxvxvxuwwvwvuutt~po|nmzojynixmhwmhwjiwkjxjiwjiwihvihvihvjiwhiwhiwehvdgubeuadt_br`cs_dt`eu^eu_fv]gv^hw]hy]hyZky[lz\m{]n|]p~^q`s`sbsararardrdrbrbrbrcsbucvdwdwdwexewfxewfxfxfxfxgyh{gzh{gzgzi|j}i|j{k|m~l}n|n|l}m~k~j}j}j}l~l~k~k~llooonnnlllmlllllk~k~k~l|m}noopnnonnoqrssutwwxxxwxxwxtttsttoi`vix|®ïįİŰŰǰDZƲdzʳʴ˳ʳȴɵ̴˴˵̴˳ʳʴ˶˶˶̵˵˵˳˳˳ʲɲɲɴɳȲɲɰǰǰȰȲȲȳȱưűƱưŮŭĭĭĭĬë¬ì||{pymvir}dn{cmzblyakx_lx^kw^kw]jv\iu\iuYhtZiuZiu[jv\iu\iu]jv^kw_mw_mw^lv^lv^kw^kw^kw^kw_lx^kw^kw^kw\kw[jvYkvZlwYkvYkvYkvXju[jvZiu[ht[ht[ht[htYhtYhtYhtYhtYhtYhtYhtYht[htZgsZgsZgs\fs\fs\fs\fsZhrZhrZhpZhpZhr[is[ht\iu^kw_lxblyfp}isnxt~z|}}~~~~~witft|iwkylzn~}µƳĴƴƴƵDzƲƳɵ$$%%%&%$(%$(%$(%$(#"& #""$ )%%+)).,,+++%%% !" #$$%"%&#%&#&'$%%%%%%"$("$(#%)#%)"%&"%&#'&#'&!'&"('!*(!*(!(+!(+!*( )'"('"(' %& %&!&)"'* '* '* '* '*!&)!&)"'*!&)#%)"$($&*%'+"'*"'*!*(!*( )'(& )' )'(& )'"(' &%!'&!'& )'(&%( '* (( ((#)($*)%*+$)*"$( "&"!%! $!%#### $! $#"&$#'%$(%%&%%&#'&"&%#'&"&%"%&#&'%$(&%)%%&%%&''(''($'($'($&*#%)$('$('%*&$)%(& )'!(+!(+)))))')'"('"('$('$('$('$('((('''''(''('&*&%)$&*$&*"'*"'*"'("'(#)("('#'&$('%)(%)(%()%()%()$'(%)($('%)(%)(%'+%'+'*+*-.1546:97<=7<=9=B;?D@AIABJ98E;:Gfappkzur|xu{x}zz|z|z|z|y{xzzyzyvxvxvxvxxxwwwvxwzuzuzvzvutsron|nm{lkxkjwmjtmjtmjtmjtlhulhumivlhulgvlgvihvihvdgubesadr_bp^dq_er^fs^fs_fv_fv^hw_ix]ix_kzZm{Zm{[n|]p~_r`s`s`sararbsbsbrbrcscsdufwdwdwexexexexfyfyfyfyfyfyfyfyfyfyfyfyfygzh{gzhyhykyjxkykyj{j{j{k|k|k|j}j}j}k~k~llmoollkkkkkkjjl~l~l~k}k~lllmmnnnnoppprsssttttvvxxyyuuttttsqdwfyryįİűƱƱƳƴǵȵȵȵȵʵʴ˴˴˴˴˳ʳʳʳʳʳʳʳʳʳʲɲɲɳȴɴɴɲɲɲɰǰȰȲȲȲȱǰưưưưůį¯®ë«««|zumwhreo|dn{blyakx`jw^kw^kw]jv]jv\iu\iu_iv^hu_ix^hw_ix_ix^kw_lx]mw^nx]mw]mw]mw]mw_lx_lx^kw_lx_lx_lx\kw\kwZlwZlwZlwZlw[jv[jv[jvZiu\iu\iu]jv\iu\iu\iuZiuZiuWitWitYkvYkv]ku\jt]ku\jt[ht[htZgsZgsZhrYgqYhnYhnYhnZio\hp\hp]iq_kscmudnvgqylv~s{z|~~~}~||}}}uiu}fu{gv|jxlzr|ijijijĴŴƴƴƴƱǵ#"&$#'$#'&%)%$(%$(#"& # !!"#)%%-))0,,**+%%&  ###%%%%%%&&&&&&%%%%%%&&&&&&&&&&&&&&&&&&&&&&&&$('$('"('#)(#)(#)(#)(#)($('$('"('"('#)(#)("('#)("'("'(#%)#%)#&'$'(''(''(''(''(%()%()"'("'("'(!&'"'("'("('"('#)(!'&!'&"('"'("'(#%)$&*$'($'(%()'*+(*.(*."$(!#' # # # #!"!"!"!""#&#'%%&&&'''(''((()''(''(''($'(%()$'(#&'#&'$'(%)(%)(#)(#)(#)(#)(#)($*)"+'!*&!*(!*("**#++#,*#,*"+)!*("+)"+)"+)"+)$*)$*)$*)%+*$)*$)*#(+#(+%)(&*)$*)$*)$*)#)($*)$*)$)*#()%*-%*-%*+%*+$)*#()$)*$)*&)*'*+')-&(,(+,+./1545985:;7<=:;C<=EA>HC@J83B>9Hdcqmlzqq{tt~xxyyzzzzzyzyyxyxwyvxvxvxvxvxwvvuvuwvzvzvzwyvwsuq~rm|ojynjwmivmjtnkunhsnhsnhunhulislislislisiishhrbesadr]cp^dq_er`fs^fs_gt]gv]gv]ix^jy]lx^my_nz`o{ap|cr~bsbsbsbsarbsdrdrdrftdteudwdwexexexfyfyexexexgxhyjxjxhvhvhvhvhvguftftftftfteshshsjvjvjxiwjxjxjxjxkylzh{j}llllnnmmkkkkkklkkkjjl~l~lmmnnooopprqqqssttttttxwxyxwwxvwvumgdwrĭĮîîůƲŴǵȵȵʵʳʴ˵̴˴˴˴˳ʳʳʳʳʳʳʳʳʳʳʲʲʴɳȴɴɴɴɳȳȳɳɲDZưǮůƮŮƮưůįįį®«ª~|{slydvas~_q|\ny`l{_kz^jy]ix]ix^jy]ix^jy^jy_kz\jy\jyZlw[mx\ny\ny\ny]oz]oz]oz\ny\ny^my^my^my_nz`o{_nz[ozZnyZnyZnyZnyZny\ny\ny\ny[mxZlwZlwZlwZlw\kw\kwZlwZlwWkvWkvYmxYmxYmxZnyYmxYmxZlwXjuWitWitVhsVhsWgqWgqYgoYgoYgoYgoYgoZhp]hs`kvflxkq}qw|z}~zz|}|sjw}hw}gv|iwlzovDZııIJŴƴƴȴȳǸ!&#("$(#%)%%&%%&""#   "!'$&++,,,-+++$$$ ""!%%$(%$(#'&$('#'&"&%"&%$(''''&&&&&&&&&&&&&&&&&&&&&"('#)(!*(!*( )' )' )' )'"('!'&"('#)(#()#()$'(#&'#'&#'&#'&$('$'($'($'($'($('%)(%)($('#%)#%)$&*$&*$('$('$('#'&$('$('#%)$&*$&*$&*%()$'(%'+')--,0+*.''(""# #"""""#$" &#!'#%)$&*&)*'*+&)*%()(()(()(()))*&)*$'(%()&)*&*)&*)&*)&*)%)(&*)&*)'+*$*)$*)$*)%+*%+*&,+(,+'+*******)))******+++++,**+++,**+++,++,**+**+)))*********',(',('+*(,+(+,(+,(+,),-(*.(*.(*.')-))***+)(,+*.,+/*)-+++///222888:8>;9?<9B>;D@=GB?I50?;6Eadrhkylp|osswtxuyvzvyuxxwxwxwxwtxtxtxswwvwvytytyuyuyuxtxrvp}rkzqjyqhvqhvqhvqhvrgurguqftqftpgupgukhrkhrjetidsabpabp^ao`cq\dq^fs\fu\fu\hw\hw_lx`my^my^my_nz`o{`q`qbsbsbsbsbsbsesesesftftgueueufvgwgwgwewdvdvbtasbtfsercpbo\o]p]p\o\o\o]n^o^o_p_p_p`r`r`r^p`qarbtbtatcvbybyf}imklljkjkkkllnonnmllll~mmopoppqqssssssttvvwvvvwwxwwwxxxxxraui}}ëĬŬŮîîŰdzƴǵȵȳʳʳ˴̵ʹ̴˴˳ȴɳȳȳȳȳʳʳʳʴ˳ʳʲɱȱȴɳȴɳȳȳȱȰǰǰǯƮŰűưưưůįįĮ­««ª~~|{tp~hxgwkyft~nvpxluoxq{r|r~uuurp~o~n}o~n}o~po}o}n|kyhv~jxm|o~ssrpp~n|qqp~qppn}l{jykzkzl{m|m|n}m|n}l{n}n}p~p~m{drz_mu_mu\kq[jpZjmZjmYhnYhnYgoYgoYgqZhrZhr[is^lv`nxkszrzy~}{|zzzz~~yq~ivzfu{gv|gxfw~j|wȱƯįıƴƴƵǵǶƺ "&"$("&%"&%%%&$$%"!%! $  !!"%%&*)-,+/**+%%&  !##$%%&%%&#&'#&'"'*$),%,/$+."(- &+&%)&%)&&'''($('%)(#,*"+)!*(!*( (( (((+'*'* ),!++!++"**"**$'($'(#%)#%)$'('*+&+,$)*"'("'(%()%()$('#'&!(+"),"),!(+!(+!(+#()"'(#()"'($)*%*+%*-#(+#(+#(+%()(+,*-.),-"$(!#' $ $#"""" #"!%$#'&%)('+').&(-&(-%',('+('+((()))%)(%)(%)(&*)%*+$)*$),$),$),%*-(+,'*+')-')-&+.&+.',/&+.'*+(+,**+))**)-+*.+*.,+/++,++,**+++,*)-+*.+)/*(.)'-)'-)(,*)-***+++(,+(,+)+/)+/)+/)+/)+/)+/)+/')-(*/(*/(*/)+0,+/*)--++0..644:88:9=<;?:C>?G@AI35A57C_bphkymr{pu~rxtzvxvxvxvxxwxwxwxwvxuwuwtvvuvuytxsxsxsyuwswq~wq~sl{qjyqgwqgwqhvpgushvrgurgurgupgupgukgtjfsidsfapbaoa`n_bp_bp_er`fs^eu_fv\gx^iz^l{^l{^my_nz`o{ap|`qar`s`s`s`satatbtbtdtdtcucucudvhvhvguftbrcsbraqap^m`k`k]k^lVkUjVlVlZl|Zl|Yk{[m}]o[m}Zl|Zl|VkzTixLf{HbwJe|MhTkRiYlZm]q^r\r^tZu[v[u^xc}ejjmmnonnonlkkjjknoopppssssstttvvvvvvwvwvwwxywwwxutnlr|¬íĭĮŮůưDzDzdzȳȳʳʴ˴˴˵̴˴˴̳˵˵˵ʵʳʳʱʱʱʱʳʲɲʲʳɳɳȳȳȳȱȰǰǯƯƯƯƮŮŮŭĭĭĬîí­­­­«~~|}xmzkxlypxjriq~go|ckxhp}hp}fn{eo|gq~gq~hrnzp|nzmypyqzrznvgq~dn{er~hukyjxnynyoznys|u~rq~p{r}q|ozo{p|r|r|s|t}pznxnxoynymxpypykyiwgvjylzlzkx~jw}jw{huyapvapvbpx`nv^lv[is\fs[erZepYdo`hoaipenrmvzr}z|~~zzzz||~ztnzht|drzft|hw}crxr|ŰůİŰųƴǵǴƵǻ#"&$#'%%&''(&&&$$$""#!!"!!"""&&&++,--.,,,%%% !##$%%%&&&#'&#'&"**%--(/2%,/%*-#(+'&*'&*'''((((((+++).)(-($*)"(' ((!)) '* '* ),#,/#.,"-+ +)*(%)($('$&*%'+"-+$/-#/)".(!*( )'%)($('%)(%)("-+#.,#.,!,**(*( )' )'!))!))&+.',/(+,&)*(((((())),,,---,,,&&&"""!!" !" #"""! $""#$$%&%)('+*)-*)-))*))*)))(((%)(%)(%()%()%()&)*&)*&)*$),$),$),%*-(*/(*/+*.+*.++,++,++++++++,++,**+**++*.,+/+*.+*.+*.*)-*)-+*.+*.+*.+*.+*.*(.)'-*)-+*.+++,,,+++,,,,+/,+/,+/,+/)+/)+/)+/)+/)+/)+/,*0,*0,+/+*.++,//04458898:>:<@;=B;=BEV;BS;AU39M28LCI]EMZFN[FP]CMZH36D8;I_bphkyjm{mp~osquswswsxrwvvuuututtstststswswswrwrzsyryt}xs|yr{yr{unwslusitsituhttgsvgsvgsvgsvgssfrreqmcslbrg`of_nbaocbp\ep]fqZgs[ht\hw^jy_j{`k|_m}_m}^o}^o}^r}_s~`t`t`satctctftftfwducubtas`r_q`r`r_q^p[mXhXhYiZjZkZkZl~Zl~Zo~Zo~Zo~]r_tbwewfxgzfyhzgyixjym|l{r~utststq}lzn|gzcv]t^uXsWrUoNh}Le|G`wEd}HgMnXyb~dmoponmlmoooprrrsuvvvvvvvvvvvvvwwwxxxwwxyyzyvnj|x«­ĭİDzɲɲɳ˳˵̴˴˴˷ʶɶɵȵȵȳʳʴ˳ʲ˱ʱʱʳȳȲdzȴɴɲɲɲɲɱȱȱȱȱȯƮůƮŮŰŰŮŭĭĭĭī¬ë«ª¬êè~~|{ylt\hwEQ`2AM)5+5$.&1%0;%+8#0!'4#)6!#5!3"$6 "4$$5%%6 .!/#&4!$2&+4"'0"$0.0<(,1&*/'.7!(1+'&-/9).1 %($++18&*6%)5$)"(-$,3#+2"(5$*7&,8$*6 *2#-5(2:#-5%+7 &2 (/&.5&.5!("+%,5$*7%+8'0;%.9$,9$,9%-:%-:+4?+4?)6B'4@%2>#0<*4<'19#--&006?=V_]nwu}}|}~~~~~~{{zwt~q{hrfp}anz_lx]jvanzct{gxk|v²³´ôŵƵƴŶǹ%"$&#%%%%(((#&'"%& "& $"" %%%***---+++&&& "! $$$$%%%'$&'$&(%')&(((((((((('''''''''''(''(*')*'))'')''(()(()%'+$&*"'(#()$)*$)*$)*#()#()#()&)*%()$('%)((-)(-)&+'%*&%)(%)(%)(%)($*)%+*&,+&,+%*+$)*$),$),$)*#()#(+$),+*.+*.*)-)(,('+('+))*,,-,,-,,-%%&##$!!"!!"! $ #! ! ###!!&$$%%&(()))*))*))***+(+,*-.',-%*+%*+%*+%+*%+*'*+'*+')-)+/'+0'+0(*/(*/*)-)(,))***+,,---.--.,,-++,**+++,**+***))),)+.+-,,-,,-*)-+*.*(.+)/*(.+)/*,0+-1&..%--(-0',/)+/)+/)+/)+/(-0).1(-0',/&+.&+.'-,(.-*,0(*.+*.-,0533977:9=;:>9;@;=B<>C?AF56>@AI`bnfhtjkyno}rq~srtststsutwt~vs}wt~wt~wswsvrwsvruq~wq~xrysys{r{ryp~xo}wlzujxvhwugvwhtvgsxgrwfqwfqwfqreqreqmbpk`nh^ni_obaocbp]er]er[ht\iu_kz`l{`k|al}`n~`n~_p~_p~_r`s`s`s`rascsdtguesftescsbraq_o^n~`p^n~^n~Wk}RfxOf|Pg}RiUl[n^qftjxmykwmzp}n}m|j{hyfyfyfyfyhzi{j|j|n}ptuywvvvyz|}xomdzXn{F`uC]rB_xHe~NiYta{d~jkoqppopoppprsssvvvvvvvvvvvvuvvvvvvuxxzzxwrfzn{®îîïưDzɲɲʳ˳˴̷ͷͷ̶˶ɶɵȵȳȳȳʳʳʳʲɳʳȳȳȲǴɴɱɳ˲ʱɲʱɱɱɰǯƯƯƮůƯǮƮƭŭŭŭŭūìĩéééé¨~~}zw}gmzU\m'.?!2&0/9;@;=B<>H`blegqflxhnzlrmsntntptosqspr~rqsrsrsrsrsruq~uq~yoyozq{r|q{p~{p~yn|xjywixygtxfs{hszgrzgryfqyfqyfqyerwcpl^nl^ng`ohapbaocbp[cp]er\hw^jy_kz`l{_m|`n}aoao`q`q`s`s`r`ras`rcscscsbrbraq^p]oZnYmWj~QdxRazXg\m]n_q`ras`rcsfviwhvitjujvkwkxkxjxjxjxjxjxjxlxlxn{mzo|o|q~rssssstwyz|{{}~xsj{ZqYpNg~Le|Ng~Yr`ygqpoopooossssttvvvvvvttrrstvwwwxxz{{|xwythzo«īīĮŮůưDZɲʳ˳˳˴̵̵̴˴˳ȳȵȵȵȵȵʵʴ˴˴ɳȳȳȳʲɲɲɲʳ˱ɱɰȱɲȲȰǯƯƯƯƮŮůƮŭĭĭĭĭĭĬìë«««ª~}|}~bhtGL\&$%312@63=41;027/16.27.27.19/2:/2:03;/2:/2:/1;02/3?/4=05>06;06;-5.6=/7>08?19@28?")000ac^}~}~~~}}|zzzyxvr~p|juepam|`l{\hw[gv]jv`mydr|es}r~²DZűųŴƴȵɵɵɻ˿$$%%%&&&&''''''%%%$#'#"&"!! $!)$&.**1--,,,'''  ###%%%&&&%%&&&'#&'$'(#'&#'&#'&$('$('$('''(''('&*&%)'&*'&*'%+'%+'%+&$*#%)$&*"('"('"('"('$&*$&*$'(#&'$('$(''''''''''((((((''''''((()))(((()&'(%((()))))*''('&*'&*'%+&$*'&*('+((()))%'+%'+')-)+/,,-**+&#'$!%#"#"! "!!!!!!!"##$&%))(,)(,)(,*)-*)-+*.+*.*(.)'-)(,)(,))*))*)(,*)--*..+/0+-/*,++,++,+*.+*.+*.,+/.+/.+//--.,,+++++++*.+*.*)-+*.,,-,,-,,-,,-',/&+.'+0&*/,+/,+/...///.-1.-1*,0)+/,*0,*0.+//,02-/3.0--.,,-++,++,++,,,-,,-++,+*.-,033477899:::;;9?<:@>;D@=F52D539@>Dfclolullvnnxmr{ns|mt}mt}mt}mt}lr~kq}pr~oq}pqop~qp}qp}spzspzwozxp{yr{xqzzp{{q|{nzzmyyjvwhtzeuydt|dp|dp|en|enzenydmucktbjo_nn^mf_nhap`cqadr\fs_iv^kw`my`l{am|bn}co~bpbpcqcqbrbras`r`r_q]o]o]oZl~Rj}Rj}Le|HaxRd|\njvp|vq{kwiuesdrfqfqfqfqfqfqgrgrjtjtjtkuktlulvmwlvlvkwkwlylylylyoyq{r|s}t~t~t~t~uwyzzzzzz{{||~{}vp~`vUk}FdzKiSo^zlnttqqqqqqrrtttttstttttuvwwxyyzyz{yzxtx¯°ñIJųƴǵȵȵȳȴɴ˴˴˴˴˴˳ʳʳʴ˳ʳʵʵʳȳȳȳȳʳʳʲɲɲɲɱȱȱȰǰǰǯƯƯƯƯƯƯƮîë««īĩ©©~~||zxzyTZf12:,-555?44>359359058/47-47-47-38-38-3:/5<,59-6:,59+48,59,59,59,59+48*37.19.19138138.27.27-38-38,27,27+3:+3:+48+48+48*37*37*37*36*36,44,44,44-55.34.34.36.36.36/47.49-38-38-38,59+48,59,59-6:-6:,59+48,59-6:.7;.7;-6:.7;.6=/7>/8;=B=?D2498:?bdilnslmunownpzoq{lr~lr~lr~lr~kq}kq}oq}oq}oq}oq}po|po|so|so|uoztnyxqzyr{{q{zpz{oyymw{ivygtyeryer|en|en~dn}cm}cm{akw_kv^jp^mp^me`ogbq^fs_gt[jv]lx\m{\m{_m|`n}bn}bn}dpdpcqdrdrdrap`o]n]nZmXkTiLawPe{Wleuk{xxvuq~mzixfuesdrdrdrdrdrfqfqfqgrfqgrhshshsititjujuitjvkwkwkwkwlxlwlwnzo{q}r~rrrtvxyyyyz{yzz{{|~}}}wn~m}]sYoUp[vfjopoppoqrrrttttrrrrrrvwwx{zzz}}||yxqt­®îïưdzȴɲɳʴ˳ʴ̴̴˴˴˴˳ʳʶ˶˵ʶ˵ʵʳȳȳȳȳȳȲDzDzdzȲɲɱƱưŰŰǰǰưƯƯƯƭĭĭĭĭĭĬìë«««~~}{zzzRXe%+8#)614B03A25=14<15:/38.27/38-38.49,59,59,59,59,59,59,58,58,66,66+47+47-38-38/38/38-38,27-38,27,27,27,29-3:-3:-3:-47,36,36,36,44,44,53,53,44,44-55-55-55-55-47-47-38-38,58,58,58+47,58,58-6:,59,59,59-6:.7;.7:/8;07:07:17>17>.9=-8<.9=0;?1<@1<@4=A3<@09=)26"#JKHijgy|}~}|ytoifb{[t~YozXnyZox\qz`r|cuh{v·ȸǴóĴŴǴǵɵɸʷ###$$$"&%$('"*" ( $$$"""# % "%!!)%%,**0..)-,$('!  !##$&%"'&#%%%%%%"('%+*#/*".) +)*("'("'("('#)(!*(#,*$-+#,*&*)%)($('$('#)(#)(!*("+)$-+"+)%)(%)($)%$)%''''''))*))*)(,)(,))))))')$')$#)("('#()%*+$),$),%'+%'+$'($'("('"('#,*$-+#,*"+)$)*$)*'*+),-,,-,,-&&'$$%""#!!" !!"!"!$!%&#'%$(('+)))*********)))((((((***)))*********-++,**))))))*+(*+(*+(*+(+,)*+(*+(*+(***,,,(,+)-,(,+(,+++++++++,++,******(,+(,+)-,(,+++,,,-,,,,,,++,++,+*.+*.+*.,+/,,,,,,,,,,,,,,-,,-,,-,,-++,,,-,,---.*,0(*.)+/*,0333777999999::;<<=>=A@?C:7@DAJgdnmjtmjspmvon{qp}pr~pr~mp~mp~op~no}no}no}on|on|so|so|rn{qmzumxvnyyoyzpz{nz{nz|myzkwzhwxfuyerzfs|en|en}dl|ck|cky`hr`hr`hj`kj`kacoceq\fs^hu]ix_kz^l{^l{`n~aoao~ao~bpcqdrdrcqbp_n^mXkXkNe{JawJawTkhxk{x|urk|hyevctbsbsdsdsfser~eqfrfrfrfqgrgrhsgshthtiuiuiukukukulvmwmwkulvqxszr|t~rrrsuvz{yyxyyzzz}}}~~tjzPn~TrVr\xforppprrrsrrrrrrrrrrtvvwzzzz}}{|||xx­®ïĮðųƴdzȳȳʴ˴˳ʴ̴̳˳˴˳ʵȵȵȵȵȵȵȵȵȵȴǵȲɳʳʲɲɲɱȱȰǰǰǯƯƯƯƮŮŮŭĭĭ­­Ĭë«««««««¨~}|zx~x~u{LR_#)6'-:06C/5B17>06=049/38/47/47-47.58.58-47,36.58,59,59,58,58,58,58.58-47-55-55-55-55-47-47-38,27,27-38+3:+3:+48+48+48*37,36,36-55,44,53,53*53+64+64*53+64+64.75.75+47,58-6:,59,59,59,59,59-6:-6:-6:-6:-69.7:07:07:38;38;/8<09=/:>/:>/:>/:>2;?3<@6A278#"AEDZ_[tyu|~~zwrmi{bv^r}]ry]ry_t{cxmxƸǴôŵƵǶȶʵɻ˾!$%"%& &%!'&#*& '#%%%!!!#"$#&!#)$&.)+1,.---&&&  !!!&$$'%%'&#('$%*&(-)%/)$.(!*( )'$'($'($('%)('+*(,+)-,(,+&*)$('(((((($('&*)&,+'-,'-,%+*&*)$(''''&&&''')))+++,,,)-,(,+',(&+'%*%%*%%)(%)(#.,$/-#.,!,*#)("('$('$('$('&*)#.,#.,",,!++$)*#()))*,,-,,-++,&&&###!!!!!!#!!" " " "!"!"!%$#'#%)%'+&*)'+****)))(((((('*+'*+')-')-***+++*********+++(,+'+*(,+(,+*+(*+(,+(,+(***,,,)-,)-,)-,'+*++++++**+**+'+*(,+)-,)-,++,**+++,,,-,,-,,-,+/,+/,*0,*0,+/,+/,,,,,,,,,++++*.,+/,+/+*.,+/,+/*.-+/.*.-(,++++...222777:79<9;:9=<;?>@J^_mbcqgiujlxlnznp|mp~mp~mp~kn|no}mn|mo{mo{nmznmznm{nm{qmzqmzumxumxxnxxnx|my|my}kx{iv{gtyer}dr}dr~dn~dndldl~di{afq_gq_gh`kial`dpbfr^hu_iv\jy^l{^l{_m|aoaobpbpbsbsar`q]o\n~WmSi{IcxHbwD^qTnp~z{zxxxxv~o{lxdubsbsbsdsdscr~cr~eqeqdrdrdrdrdresesesgsiuisjtjtjtjtlvkwjvhtjvlxnzo{p|q}r~r~r~tuxyyywxyyyz||}}}}~~|t_yWqTn_yh~nppsrrrrssstttttttvvwyzz{{{{|||{xy°ðñƲdzƴǵȵȵȶɵ̴˴˴˴˴˵ʵʵȵȵȵȵʵʵʵʵȴDzdzȲDzdzʲɲɲɲDZƱƱƱưůƯƯƯƯƮŮí­­¯®îí­­­­¬~~}{yx~w}u{NTa&,9.4A06C/5B/7>/7>058058058058.58.58+47+47+48,59-6:-6:.7;,59,59,59+48,59+47,58,66,66,58,58-47-47-47-47.49-38.49.49-38-38-38-38*36*36*44+55+55+55+55*44+64+64+55+55,58-69-6:.7;.7;,59,59-6:-6:.7;.7:.7:.88.88/99/9918;18;/8;/8;/;=/;=1>=1>=3==3==5:56>46:359167167/77/77.66-55+47,58,59,59-6:.7;.7;-6:,59,59/69.58.58/69/69/69.49.49-38.49.49.49.58.58.58-47-47-47-47.58,58,58,58,58+64+64+64,75,66+55,58,58-69-69.7:-69-69,58-6:.7;.7:-69.88/99/:8/:819919918;29<09<1:=2;>3A8?B8?B9@C8?B29<-55,44?D?TYTqroz~pzfpxcrxetzfu{fu{vĶĴöŶǷȷɶȶȷɺɺ$!#'$&%%&''('&*&%)%#)!%##$$$$' '-',0*/,+/('+!!"$ %!!*#$+$%*&&*&&&&&''''''&&&$'(%()%()#&'&&&'''*((*((+))+))((((((''''''''(''(((()))))*(()(()''(''''''&&&'''))))))))))))))))))))*(()&)*'*+'*+'*+&(,%'+%()%()&)*%()&)*(+,',-&+,%*-$),''((())(,,+/,+/,+/%%&##$$""#!!" " $ ##$ %!!($$'$(*'+,**,********(-.,12&1/#.,$,,#++**+++,++,,,-),-,/0&..%--&+.&+.++,**+***+++-.+./,*.-)-,(*.)+/(+,(+,++,,,----------,,,++,++,,+/,+/,+/,+/+/.,0/,0/)-,),-),-,,-,,-+++,,,---///../,,-+*.,+/,+/,+/)+/')-+++,,,622844;77<88<6;>8=;9?>:;CYYcaakifplisolvpmwnmznmzon{on{qnxqnxqmzplyplyplyqkxqkxrlwrlwtmvunwymwymw{mwzlv{juzit{foydm}dl}dlbkbkaj_h{`h{`hl[fn]habpcdrZgs\iu]jv_lx`my`myam|co~dpco~cncn`m_l\k[j~Vd{P^uOYn`jy}|zzyyxwu~s|nyjudrdrbpbpcqbpbpbpeqdpdpdpepepepfqfqfqfqgrfrhthuhuiuiuivivivivlvnxpxrzq{r|s}t~t~t~xyxyzyyyyz|||||}}~~~}~~~}uey^r\pdxrxxtuussssssrrttuuvwz{{{{{||||{|ĭĮŮŮưȳȴɵȵȵȵȵȶɶ˵ʶ˵ʵʵʵʵʳ˳˳˳˳˳˳ʳʳʳʳʲɲʳ˰ɰɰɯȱȱȯƯưǯƯƮŮŮŮŭĭĭīĪê髪ª~||zyvu~s|pvMS`%(6/2@47E36D57A35?46;46;18;07:.88.88/69.58-38-38-38-38/5:/5:/5<.4;/5:.49.49.49.49.49-6:,59,4;,4;/2:14<14<14<,59,59,58+47,58,58,59+48,59,59,59,59,59,59,59,59,59,59.49.49/5:06;/5:06;-6:-6:.7;.7;.7;.7;.7;/8<09<09<09=09=08?/7>17>28?4:A5;B6C8>C8>C9?D;AF;AF9?D17<'-,&,+SUPqsn{wpzis{es{es{hyzk|}p~ĵĹƸŸǸǶǷȷɸʷƸ$ &'#)&$*&$*%'+$&*%%&""#!"!"$$(!(-',0*/--.''("!! #"'!&&$$'%%%%%%%%%%%&&&#'&$('$'($'($'($'($('$('(((((('&*'&*)&*)&*)&*)&*&&'''(''(''(('+('+(()''(&&'&&'&&'&&'*'))&((()(()(()(()(()(()))*))*))*(()$'($'(%)(%)(%)(%)(%)(&*))(,('+%'+%'+%'+%'+&(-)+0,*0,*0&&'""#!!"!!"! "!! ! ! "!$!%$!%($*)%+))*))*))***+)+/+-1*-.(+,************+++,,,.-1/.2-,0,+/+*.+*.++,++,++++++./,/0----,,,+*.+*.,,-,,-,,,,,,/--0...,,.,,-*.-*.,+/+*.+*.,+/000111/1,.0+,,,,,,,,-++,,,-//02005330...,,-*.-*..+/.+/.+/,)-+(,.+/5/493896:96:86<86<9:B;@J\Ycc`jheokhrmhwnixojyql{nm{mlzlkylkyojyojyojyojyokxokxrlyqkxsjxsjxxkwxkw{mwzlv}ks{iq|en{dmbkbkaj`i_h^gw]gw]gi^lj_m^dq`fs[ht]jv^kw`my`myanzbn}co~bn}bn}`m_lZkYj~Tc|KZsN[tfsx}|||{z|{w~v}oymwgseqdodododocndodododoepepepfqepfqfqfqfqdreseseshthtgsgsiuhtjvkwlymzo|p}q}q}q}r~vyxxxzyxzzyyyyzz{{{|~{xmZl~[j`ol~xxutttsrsuuuvuvvxz{{{{{|||}yëīīĬűɱɰɱʱȱȱȱȴ˴˴˳ʳʴ˶˶˵˵˵˵˳ʳʳʳʳʳʵʴɲɲɲʳ˴˲ɱȲɱȰDZDZDzȲȰưưŰŰï­­­¬©¨~{ywvu~s|lr>DQ),:14B68D57C:7@96?96?85>38;38;27:27:27:169/38/38/38/3803;03;14<25=06;06;06;/5:/5:06;.6=.6=-5<-5<-5<-5E7?F6>E9>G9>G9=I:>J:?H;@I17<17<17<17<17<06;/5:.49-6:+48*37&/3!+2!+2!.2!.2)+')(,!,0!+3!+3+3(0 +/(,')+-!-/!-/!,0*. +/)-(,!,0 -1,0)++-.--,+.-0,2,2)+-/ .0,.*2".6 .6*2/2-0 +/!,0)1 *2%/7",4%/7&08"/5(5;"25 03"17 /5!/9"0:$-8,5@1:E1:E2;F/8C.EN*077=D39>39>6:?828=17<17>17>17>06=-5<.6=*7=+8>#4;#4;5B7D8I:K5F,=,B4J.D-C-<)8/</<,7-8 2=#5@!4B1?4A1>0=4A7E1?1>6C5@/:.<#6D"6A1<1:!6?-8+6+83@5B/<4>2<,:1?,:/=$4D!1A#5E"4D1<#9D1<0;3B*9/A,>&94G+;K#3C'7G&6F'9K);M'9I+=M(:E&8C#6D1? ( FORuw|{tzmsio{flxio{jt{nxv~ȴŴŴŷǷǶȷɶȷɸǸ##$%%&!&'"'(!'& &%$$$!!!!!# "&#%***,,,---'''"!" $"!%#"&&#%'$&'%%)''&*)(,+#,(!*&"('!'&%%&&&'%%&''('''((('''&&&&&'&&'(%)'$(%%&&&'((()))&&&&&&%()$'(#&'#&'%%%%%%&&&&&&&&&&&&&&&%%%'''''''''(((%)(%)(%)(%)($('$('#'&$('#&'%()(()(()(()(()(()**+,,-++,&&&!!!    ! $"!%%#)'%+('+('+)(,)(,)(,)(,))***+'*+&)*')-')-&(,')-*********++++++****)-)(,*(.+)/+*.+*.++,++,++,++,+*.+*.+*.+*.,+/,+/+)/+)/*(.)'-)(,*)-*)-+*.,+/,+/,+/,+/,+/,+/,+/+*.,,-++,++,,,-,+/,+/,+/,+/,+/,+/,,-**+-))1--4/183573973963<74=54A76C-0>97;@9=B5;@4:?28=28=37<48=36>36>/7>-5+JVoztyjp|Z`lX`m[cp^jriu}xųĴŴŵǵǶȶȷɵǸǻ%%%&&&#&'$'(#&'"%&!$% #$ # "'$&+(*/,.*.-%)(   #"&$#'$$%&&'#($',(#/)#/)!,**(#&'#&'#&'#&'$(''+*(-)',(%)(#'&%%%&&&&&'&&'&%))(,'*+%()#(+"'*"'*!&)#&'#&'$(''+*%()%()#'&"&%&&&&&&$'(%()$(-%).%(0$'/#',#',%'+$&*#%)%'+%(0%(0$&0$&0&(,%'+(()**+,,-++,%$(#"& ! ! !   ""! $$#'&$*(&,('+('+(()(()(((((((((***&(,')-%*-%*-*)-*)-))*))****+++********+**+*)-*)-*)-)(,*)-*)-+*.+*.+*.+*.+*.+*.+)/*(.+)/*(.*)-*)-,**,********,,-,,-,+/,+/,+/,+/+*.,+/++,**+,)+-*,+*.,+/+)/,*0,+/,+/,+/*)-+(*.+-3//62274674652;74=55?66@02>8:FUYeZ^jZ_h]bkbaocbpfesfesgftgftferferierierlfslfsnhunhuoitoitsjqtkrviuuhtwhtvgsxepwdozclybky`hx_gy^fw\do]en\de_licp^eu_fv\hw^jy^l|_m}\n~\n~[m}[m}Zl|XjzQdxM`tPaubsv}}||zyxvsp}kwfrcqao`n~aobm~bm~cl}dm~cnbm~cndoco~co~co~co~co~bn}co~co~cp|dq}er~er~er~fsgsgsishrhrjtkulvkxlymzn{o{o{r|t~uxvvwwwwxxxxwxxxxyzz||}}~~~~~~of}JkLmclttttwxxyuvwwwwyz||||¯°űƲdzȴǴǵȵȶɶɴɵʵʴɴɴɵʵʵ˶̳ʳʳʳʳʳʵ˵˵˴ʲʲʲɲɲDZƱȱȱɱɰǰDZȰǰǯƯįĬë«īĪê驨|{zxt~q{nxjt`jw1;H)-959E6:?59>6=@6=@4=A3<@3;B19@07@07@/6?/6?)7A,:D#BN8Wc+]s:l)l+n"lhjjilii"l jehlhjljilnkhgiijjfhiji iebf%k#i!jhgjkhif gf"j#k"j!i$l)q$m"k'p'p)n&k$j&l&o"k"h"h"h#i"i$k'n"i i i%l#jPkFaDi~\x}pu~ekwV\hDP_EQ`L]kWhvvǴõƴųƳƵǵǶȶȸŻ$$%%%&%$(&%)'&*%$($$$$$$!!! ""#%%&**+--.---(((!!!"! $##$$$%%%&%%&$(''+*&,+%+*%()$'(#&'#&'#'&%)(&+'(-),-**+(((('''&&'&&'&&'''())***+(,+&*)&)*$'($&*#%)#&'%()&*))-,%+*#)(#'&#'&#'&"&%$'(%()$*/%+0#,0 )-"&+"&+$&*$&*%'+&(,%+2%+2"*1 (/#(+#(+&(,(*.,+/*)-%$("!%## !  ""!%$"(&%)('+(()(()(()(()))*(())(,)(,%*-%*-%).%).*)-)(,))*))**)-*)-*)-+*.+*.*)-**+**+)))*****+,,-+*.+*.+*.+*.+)/*(.*(.+)/*(.*(.,)-+(,+)),****+))**)-+*.,*0,*0,*0,*0,+/,+/++,**+**+++,,+/+*.*(.+)/,+/-,0,+/*)--(*0+-2..62243754853975;36>47?04@7;GRW`W\eX]f\aj]`n_bpbcqcdrcdrcdrcdrcdrhcrhcrhcridsjgqkhrlfqmgrqgrrhsrhsrhstgstgsxepvcnxajv_hw]gv\fu[etZdl[fm\g_`ncdr[gv\hw]ix`l{_m}`n~[p[pYn}Xm|ReyNauL_u^qs~|}|xvvuro|jwfscnal}alalal}al}al}bm~`n~`n~aoaocncnal}bm~bm~al}bn}am|am|co~co~co~dofqfrfrfrgsfrfrhshsiulxmymynzo{o{q}t~uvwxwxxzyxxvvvxxxxyz||}}~~~~~~oTlLj]{ltusuuutuuwwwwyz|||}­®ůƳȲǴǴǴɵʵʶ˶ɶɷʶɶɶɵʵʶ̶̴̴̳ʳʳʳʳʳʳʲɲɲɲɱȱȱȲɱȱȱȰǰǰǯưǯƮŮůƮūīĪêë««~}{yw}tzqypxckx-5B%(658F78@78@9;@://9::DTU]YZb[Zg^]j^_m_`n`aoabpabpabpcbpcbpcbpcbpfapgbqheoheokerkermdrnesqftqftsfrreqwdotalu^gu^gs[gqYeoYfnXecYif\l]br`eu[gv]ix_kz`l{`n}bpZp}Yo|Tj}OexH]sSh~guq~~}{zyrn|iver~bm`k~`k~`k~`k|al}al}bm~`n~ao`n~aobm~bm~bm~al}bm~al}al}al}al}al}bm~bm~bm~dodoepfqfqfqfqdresfthvjxjxmymynzo{s}t~uvwvwxxxxxwxvwxxxyz||}}}}~~~~yr]wXrXriwutuuuuuvwyyyzzz{{|}}­®ůưǰDzɲɳȳȴɴɴɴɴɴɶɶɶ˵ʵʶ˵ʵʳʴ˱ʱʱʱʱʰɲɲɲɲɱȱȰDZȴɳȰȰȰǰǰǮŮŭĭĮūĪêê骪~}zx~t|rznxnxeo|+5B#028E66@77A79>8:?6:?8>]JSkZc{tȴôõIJŲŴƵǷǸȷĶ"%&"%&"%&$'(#%)#%)%%&##$" !#)%%-))0,,,,-))* $ #%!!&$$&$$'%%'%%%$(&%)''(&&'&&'&&'%%%&&&&&&&&&(%')&((%)(%)''(&&'&&'%%&&&'&&'''''''&&&&&&&&&''''''''''''''''''&&&'''&&&'(%&'$&&&&&&&&'&&''&*('+)&*)&*(%))&*)&*)&*('+)(,')-')-#(+"'*"'*"'*'&**)-,+/,+/%$(#"& #"####""# "%"$'%%*((*((*(((((+++)-,*.-%--%--$,,"**))***+,)+,)+,,---.-+1,*0*(.*(.*)-+*.***+++)./)./(-0',/,+/+*.+*.,+/+++,,,*0/+10+-1)+/+*.*)-,(.,(.,)-.+/--...////,,,---,,,,,-,,-.,,/--1//1///,..+-++,++,+++-----.))*+(*-*,1//31133333344555664:75;1.7<9BSS]WWa\Xe_[ha]jc_ld`md`meand`md`md`md`meaneblfcmhclhclkdmlenndnoeooeooeoseoseoubms`kr`ho]eoYemWckVflWga[md^p]dt^eu]hy^iz^l{_m|`r}_q|[m}WiyJ]sI\rWg~fvz~~~|{zyzt~nxhtco~al`k~`k~`k~`l{am|am|bn}bn}bn}cp|cp|cp|anzam|bn}bm~al}am|am|am|am|cm|cm|cm|dn}cncneqfrdrdrdresetfujwlylylyoyq{t|t|v~xwxvwvvvvvvvvwwz||}{|}|}~~~~~|j|Vl~Si{lrtsutwwwx{{{{zz{{|}­®îïưDZƲdzȳȴɴɴɵʴɴɴɴɴɴɴɳȴɳȳʳʳ˳˱˱˱ʱʲɲɲɲɱȱȱȱȱȰǰǯƯƯƯƮűưŭĭīīĩĨè©©©©©§~|{xvt|rzlyly`my)6B)36D65B76C88B88B4:?6B3;B3;B-;E0>HCP2Wd+i*hhgii jkkk j j k kkjihiihhii j k lmmmmlmlkjkkllji j jmmm lkllmllmmnmmmnnnooo n n$n$n$n%o"n#ooo n n"n"n$n%o(q)r-r-r,g}9tex~}ojyd_nMD`;2N>>d??eMUo\d~x¼ɴ´óijijŴƵŶƶij!#'"$(#%)$&*#()!&' &%$#  #$#'+(,.+/---((("""!$""&%"'&#%%%%%%%%&''(#&'$'(#&'#&'%%&%%&%%&%%&&%)'&*''(''(''''''&&&%%%&&&'''''''''&&&&&&''''''''''''$('%)($('#'&&&&&&&'(%'(%'''&&&%%%&&&''(''((()&&'''((()('+'&*%'+%'+$)*$)*#)("('#&'#&'(()++,,,-++,%%&!!"  """"" #"""$$$%%&(()))*(())))++++++++++*.*)-**+**+***)))))*++,.*0.*0.*0.*0/(/.'.-*.,)-**+++,*,0+-1*,1)+0,*0,*0,+/+*.++,,,-/.20/3/.2,+/-*.,)-,)-,)-*)-,+///////...,,,,,,,,,,,,,,,,,,...1//200/--.,,,,-++,,,---.,,-**+)&(-*,1--51153353352663775;75;55?==GNPZRT^WYeZ\h\^j^`l^`j^`j^`j^`j^`l^`l`_l`_la`mbanbckbckfclgdmfclgdmjcljcllblmcmocml`jl^fi[ciWdhVcaXfd[i\_m`cq[gv\hw]ix`l{^l{`n}\n~XjzP`wIYpN^u]mv}~}||yu}qyhreo|`k|`k|`k|`k|`k|`k|al}al}_m|`n}`o{ap|bo{anz`l{am|`l{am|al}`k|`l{am|am|am|`l{am|bm~cndpeqeqeqfreqfrfrhskvlwmxmynzq{r|t~t~sttuuuvuuvvwwwxyyy{{|}}}~~~~~qczNl|Ywjnrqtuuvyyyyz{{|}}©¬ŬůưDZȲɳʳʴ˴˴ɴɶɶɶɶɶɶɶɵȵȶɳʲɳʳʳ˳˳ʲɴɴɴɴɲDzDZƱưŰűưůįĮŮŮïĮí­­­Ĭììê««©~}yxv}szszu|fmv7>G#&.8;C68=8:?8:?8:?6:?7;@7=B7=B5>B5>B->E2CJ%Q_:ft*o#hggiikk m l m m m mlljjii j j i j j j klmmlmlll klmnm k k k kmmnmmmmnnonnnonnmnoo n n$n$n$n$nooppqppooopo"r#s,s,s0r%g>lQ}z|edrPO]33R66U9=d;?fIUqZfuƲõŵŵŵŶƶƶƸȺö "&!#'#&'$'($*)"(' &%%$"!! "!%%$(*(.-+1,.3'). "'! ""#%%%%%%%%%%%%#%)#%)#%)#%)#%)#%)&&'%%&%%&&&'''(&&''&*('+''(&&'&&&&&&&&&''''&*'&*&%)&%)''((()''''''''''''''''''''''''%)($('$('$('$('$(''''(((((('''''((()(()(()'&*('+%'+&(,$*)#)("'("'(('+*)-,+/+*.%%&##$ ! !"""""#!!"$$%'&*('+))))))))))))))*))*))***+))*))*)(,)(,*)-+*..+/.+/.+/.+/+)/+)/+)/*(.*(.,*0*,1*,1)+0)+0,*0+)/+*.*)-,,,,,,.-1-,0-*3,)2,+/,+/,,-++,+*.-,0.-1-,0--.,,-,,-,,-,+/,+/,,---.1,.2-//,0.+/,*0+)/)+/*,0,,,)))*'),)+1--51153342241563764:75;85>@=FOQ[SU_WYeY[g[]g\^h__i``j_^k`_l_^k_^k_^k`_l`_la`maakaakdajebkebkebkibkibkkakkakm`lk^jj[ggXdfVefVe^Zgc_lZbo^fs[ht^kw^l{bp^o}]n|Vi}GZnM^yXifts~~}|x~t{pwgtbo{_m|^l{`k|_j{`k|`k|al}al}am|bn}bn}am|am|`l{`k|`k|`k|`k|`k|`k|`l{`l{`l{`l{`l{`l{am|bn}bn}dpdq}dq}er~er~frfrgsiukwlxnxoypzpzs}t~rrstsstuuuvvvvxy{|z{{|}~~~~~~xtWsPlWugrrtruuyyzzzz|}«¬ŬůȰɳʳʳʳʴ˴˴˵̴ɴɴɴɵȵȵȵȵȵȳȳȳȳȳʳʳ˳˳˳˲ʲʲʲʲʰȱȱȰŰůįįƯƯƮŮŭĭĭĭĭĬë«ëééé©©~|zx~v|tzryryflx7=I)+779E59>7;@5;@5;@5;@6B5>B3=D4>E)>G,AJ&Th8fz-s"hiijh jk l m m m j jiiiihi i i i hjjkkmmlmnn n nooo n n lmlnnmmmlmnmnnnnnnnoooooo"n"n#o#oppppppppoppq q!r*s*s,s'n,i&c\~sxwYXmA@U+-S79_8Ag8AgDSlSb{qɳĵĵijųŴƴƴƷɼź" &$"(%$('&*'&*'&*"$("$(!#'!%$#'&%)*)-.-1,/0(+,!%  ""#%%&%%&%%&&&'#%)#%)"%-"%-"%-"%-#%)#%)#&'#&'#&'$'(#(+#(+!%*!%*$&*#%)#%)$&*#%*#%*$&+$&+'%+'%+'&*'&*'&*'&*"'*#(+#()"'($'("%&#&'$'($('#'&#'&$('$('#'&%'+&(,%'+$&*$&*$&*%'+%'+$&*$&*$&*$&*('++*.,+/+*.%#)" &"" #"!"## $#!'%#)(&,('+('+%'+%'+%()&)*(()))*)(,*)-)'-)'-)'-*(.**+++,++,**++*.,+/+)/*(.*(.,*0,*0,*0+)/+)/+)/+)/+*.+*.)+/)+/,+/,+/,+/,+/++,++,++,++,*(.,*0,*0,*0,*0,*0,*0,*0)+/)+/,,-,,-.+-.+-.+/,)-*)-+*.,,-,,-,,-))*(()**+0-/30221510420631752;63<10=;:GLO]OR`TUcWXf^Zg_[h`[jb]l]_k]_k\]k\]k^]k^]k^]j_^k``j``jc`jc`jc_ld`mf`kf`ki_ji_jh]kf[idYgcXf`WebYg]\ja`n[et\fu]ix`l{cqes\l|VfvIZuDUp[jl{x~~}|yv}q{lvdr`n}_m}^l|`k|`k|_j{`k|`k|`k|^l|^l|^l|^l|`k|`k|`l{`l{`l{`l{^l{^l{^l|^l|`k|`k|_j{`k|`k|`k|`l{bn}dpco~dpeqfrfrfrgsjvlxlxlxnxpzq{s}r~ssssttsuvwxwxyzz{{|}~}}~~~{ylTnWqitxstuwwyzzz{|~ëĬŭƮǯȰɱʱʱʲ˴˵̳ͳͳ̴̳ɴɳȴɵʵʵʵʳʳʱʱʱʱʱʱʲɳʲɲɲʲʲɱȱưŰűƮŮŮŬìŬŮŭĮŭĭĭĬìììèĨħ¦~{x~v|u{syrxpvciv06C .47E39@4:A7;@7;@7;@7;@632?-.<9:HKN\NQ_RUcUXfUXfWZhY\jY\jY]iY]iY]iY]iY\jY\j]\j]\j^]k_^lb]lb]lb]lb]lc^mb]le[kdZjcYicYiaWg`Vf\Wf`[jZ`m]cpZgs[ht^l{es`s[n|N^uIYpRa|crs~~}|{{x~qymudpam|^l{^l{^l|\jz_j{`k|`k|`k|`k|`k|`k|`k|`k|`k|`l{`l{]kz]kz]k{^l|^l|]k{]k{]k{^l|]k{`k|_j{`k|al}bm~cncndodoepepfqitjukvlwlwmxozq|r}r}r}s~r~ssr~uustuvxxzz{|||}}~~~|m\rRld~uxttwwvwxx{||}êëĬŭƯȱʰɱʲ˱˲̳ͳʹ̴̴˵̴˴˳ʳʵʵʵʵʳʳʳȴɳȳȳȳȵʴɲɳʱʱʯƯƱưŰűưůĮïĮîîŭĭĭĭĭĬìëĪêêé¨~}{x~w}tzrxrxrxciv17D !/78F59>6:?8:?9;@8:?9;@79C8:D5h6:?7<=7<=7;@7;@6E*2;?4;>5B6?C)>G-BK/\n>?KONQUTQT\SV^SU_TV`TXdTXdSYeSYeSZcRYbSYeRXdSZcSZcV[dV[dXZfWYe]Yf\Xe\Xe\XeZZdZZdWYcUWaVYgY\jUbnWdp]ozfxdz[q~I]oH\n`rk}x}|zyvur~nzhtdpal}_j{_j{^iz^jy^jy^jy]ix^jy]ix]hy]hy]hy]hy]ix]ix^jy^jy^jy]ix]ix^jy]ix\hw\gx]hy]hy^iz^iz^iz^jy_kz_kz`l{`mybo{cp|cp|co~dpfrfrgtivkxlylyn{o|o|p}q~q}r~rrrrt~t~uuwyxxxyz{|}~~vi:`qNtnrxxwwxxyz}~¯įİűƱƲdzȳȴɴɳʴ˳̳̳̳̳̳̳̲˱ʱʱʲ˲ɱȳȳȳʳʵʵʳʳʳʳʱȰǯƯƭƭƭȭȭƭƮưȲDZưŰůįįįĭ¬ììë««ª}zvtr}r{pypyox`kv1B3>B(jx.p*lkklkjkkk l m lm mn kmmmllmlmmo n no n n n m l m n n m m m m m n n n n m m m m m n nqqnonnnnnoppppopoppqrqoonoqppqqqqqqpopoplfbe=t=t>Z*R),d=@xGHrKLvT[yahful{{³İ²ĵĵŴĶµ!%$"&%"('"('$)*#()"('!'&!'&!'&#'&$('(,++/.,1-(-)#$! !$!#'$&''(''("('"('!'& &%!&)"'*!&'!&'$('$('$('$('$'(#&'%()%()%)($('$('#'&#'&#'&#'&#'&$('$('''((()''(''(''(&&'&&&&&&&&&&&&&&&&&&'''''''''&&&&&&'''''''''$('%)(%()%()%'+%'+%'+$&*''(''())),,,---,,,''(""# #"" #  ## $#!'&$*'%+&(,&(,&)*'*+',-&+,',/&+.%).%).(*/(*/*(.+)/,*0,*0,*0,*0,+/,+/&+.&+.',/',/',/',/'+0'+0',/',/)+/)+/(*.)+/,*0,*0,)3+(2+(1*'0*(.+)/)+/)+/+-2+-2-*3,)2+*.+*.++,,,-),-),-),-),-',/',/&*/'+0'+0(,1*,0(*.%()(+,*-.-01.04,.2,.3/1602713807:7>AELOIPSNT[OU\PT`RVbRXeRXePYdQZeO[cNZbOXcPYdQZeQZeTZgSYfSYfSYfUXfUXfWXfWXfWXfWXfTWeSVdQYfV^kT`o[gvqk}Xm|@UdEWocusy~}|yw}qwhp}fn{`l{_kz^jy^jy^jy]ix^jy]ix]hy]hy\gx]hy\hw]ix]ix]ix[ixZhw[iyZhxZhxZhxZhxZhxZhxZhx]ix]ix]ix^jy^jy_kz]lx]lx^my^myam|am|bn}dpepepfrhtjwlyjyl{l{m|p|q}q}q}q}r~r~r~r~r~t~vuwxxxyz{}}~~jPh{Vss|vwwxxyz}}­¯ıƱƲdzȳȳȴɶ˶˵ʶ˶˶˵ʵʵʷʶɶ˶˳ʴ˴ɳȳȳȳʳʵʶ˵ʴɲɲɰǯƯƯƯȭƮǮǯǯDZƱƱƱƱưůįįįįĮììì~|zw~v}tzrxs{s{akr+5< &228D47?69A6:?6:?5;@6B5>B3?A4@B)>E'?EMMIQQLP\OS_PSaQTbRUcSVdQWdRXePVcPVcPVcPVcQWdRXeSYfSYfSYfSYfUXfUXfWXfVWeVWeVWeSYfSYfOVfX_o`n}hveyXl~I[sJ\t]lq~}{x}twpsgl|fk{`k|_j{_j{]hy]hy]hy]hy]hy]hy]hy\gx\gx\gx\gx\gx[fw\gx[fw[fw\gx\gx\gx\gx\gx]hy]hy\hw]ix]ix]ix]ix]ix]jv]jv^jy_kz`k|`k|al}bm~enfogqisivjwlymzn{n{o{p|p}p}q~rrrt~t~t~uwxyzxyz{||~{fzJh~Usuyzuxx{|}¬îůƯưDZȳȴɵʵʵʶ˶˵ʶ͵̷ͷͶ̶̴̴̴̴̴˴˴˳ʵʵʵʵʴʴʲʲʰɰɯȯȯȮDZȱȱȱȲŲűııưŭŭūīīīī««ªé¨~~|yx~v|tzrxr|lv~^ho/9@"(417C57C57C88B77A68B8:D6B5@D)?D)?D6bpAm{4q-j"i"iiikklkijlmruz!"% ~vrqrqpp opo n n m ml k k j j j j i j kjiii klll nom lmmppooppppq pstuuqrs prttu u tvxsqp lrvx w { {{~|z n]D}8q7f1KzTe\mewk}yµIJķƵ%%%%%%%%%&&&'''&&&%%%%%%%%%&&&((((((++,,,-)/.'-,%$  $#("')#(&&&'''#&'#&'#&'%()%)($('&&&%%%&&&%%%&&'&&''&*('+)(,)(,'&*&%)%%&%%&%%%&&&$('$('$'(#&''&*'&*'&*&%)&&'''(''(''(''(''((()''(''(&&'&&'''(&&'''(#&'#&'%()$'($('$('%()$'('&*'&*&%)'&*('+,+/).1(-0"'*#& # # ! !! ! !# "!#%!'%$('&*%()&)*))))))))*))*))))))**+))***+**+**+++,*)-*)-+*.,+/,,-++,*)-*)-+*.+*.**+++,++,++,,,-,,-,+/,+/,,-,,-+++*****+++,+*.*)-*)-+*.++,++,,,-++,,+/+*.++,++,,,-,,-,,-++,++,,,-(*.(*.(*.(*.,+/.-1*-.&)*%()&)*)+/*,0.,2/-3/-31/52063173599;?GKPKOTLO]OR`OR`PSaQTbRUcPVcPVcPVcPVcPVcPVcOUbQWdQVfRWgQWdRXeTWeTWeTXdTXdQWcRXdQYfS[hR\k\funzuWl{CXg=UoXpl~{~}{x~qwlrel|dk{`k|_j{^jy^jy]ix]ix]ix]ixZhxZhxZhxYgwYgwYgw[fwZevZevZevZfu[gvYgvYgvZhwYgv[gv[gv\gx\gx[fw[fw\hw]ix\hw\hw[ix[ix]k{]k{`k|`k|fm}hohojqksmumwnxlymzmzo|o|p}q~rrruuwxxyxyz{||}~fIcvVss}vxwzz~¬­ĮűƲDzdzȲɲɳʳʳʴ˶͵̶͵̵ʵʵ̵̲˳̲˲˲ɲɴɳȳȳȳʳʳʲɲɲɲɲɲɰǰǰǰDZȯȯȯƮŰŰŮîîîììé©©ĩĩ©¨}|zxw}u{tzrxtzpv`ho5=D&+438A37C48D57A68B68B68B7:B8;C5>B6?C+@G*?F5bt@m-o)k!k!kkjklllklnqvz/1EB4+~}{ z w v t t s qo n n m j h g g f fgggggg hjl k m n m mnoppqr tuw u v u yz {| { z z| } ~ 2.- ~aFy+]HzPeZoi{n~óõij³³²µı%%%$$$%%%&&&'''&&&&&&%%%%%%'''''(''(*)-,+/-.+*+(!&"!%!!%##'%%%%%&&&#'&$('$*)&,+#+%"*$#'&"&%%%%%%%&&'(()&(,&(,%'+%'+$('#'&%%%%%%%%%'''%()&)*$'($'($&*"$(#%)#%)#&'$'())))))$('$('%)(%)($('$('#'&$('#'&#'&$('#'&$('$('''''''$'($'($&*$&*'&*'&*('+,+/+-1*,0%'+!% ! ! ! "" $#!'%%&''(%)(%)(&*)%)(((((((((()))***************+++'+*(,+'*+(+,),-'*+'*+'*+++++++***++++++***++,++,+*.+*.+++***********+++,)(,*)-*)-*)-&+,%*+&,+'-,++++++***+++,,,,,,++,++,,,-,,-+*.+*.+*.+*.,,---.,,,***&&&***,+/.-1/-3.,2/-31/5/16027/2:69AFJVJNZJP]LR_MS`NTaOUbOUbPVbOUaOUaQWcPVcPVcPUePUeQVfQVfQVfQVfRXeRXeQWdPVcNVcOWdOYfR\i`myp}lzcq8L^?Se^ol}~~}zw}ksgo|`jwakx_kz^jy\jy\jy[ix[ix[ixZhw\hw\hw[fw[fwYgvYgvYgvXfuZfuZfuZfuZfuYgvXfuXfvXfvZev[fw[fw[fwYgwYgwYgwZhxZhxZhx\hw]ix]ix]ix^jy`l{am|bn}dpeqfshuivkxlylylxnznzp|p|q}rrrsstvxxyzz{|}l?evMss|zy||}~¯İŰűƲɳʴ˵̵ʵʶ˶˶˶˶˶˵ʵʵʵʳ̲˲˱ʱȲɲɱȱȱȱȱȱʱʱʰɲɲɱȱȰǰDZȰǯɯɯȮǮŭĮîððîí««©©©©¨ª}|{zw~u|qypxu}px`gp/6?(29B19@2:A2;?2;?4:?4:?7:B8;C5=D6>E'!-37C39>39>6:?6:?8:?9;@9;@9;@8C/AD1CF9fpAnx(m'llklllkkmppuz%,<-:2xjd~l*4/!~{z y x u s p n m k h fe a ` ` ` _`accefhh j k kl mn otvw z| {| }~  $ &)''$#''-1?9:96BRJ0p[#OpCog}k~´ó³ijijųŲòó³¹³%'"%'"&'$'(%'(%'(%%%%%%%%%%&&&&&&&&&***---./,+,)%%%!!!%##'%%%%%&&&&&&'''''''''''''''%%%%%%&&&'''''''''''(&&'%%%&&&&&&&&&&&&&&&'''((()))'''$('$('$('$('#'&$('&*)'+*)))(((&&&'''''''''&&&&&&'''''''''''''''''''(%'(%'(%'(%'(%'(%$('%)(%)(%)('+*)-,+/.)-,$'("#""  ""##!#$ &'$&)&(((()))************,,,,,,++++++***++++++******+++,,-++,++,**+**+**+))))))***+++++++++(,+(,+)-,)-,(+,'*+***++++++++++++************)))***+++***+++,,,,,,),-),-)+/)+/,,-++,+*.+*.+*.+*.,,,---,,,)))'''))),,,...//0//0../001215215539=;AJHNLJPPMWSPZMP^NQ_NTaNTaNT`NT`NT`MS_NTaOUbPVcPVcQWcRXdQWdPVcPVcPVcNTaNTaNUeQXhT`ogsqcs>Tg/EXdvk}|zvr{ir}gp{bly`jw]ix]ix\gx[fw\gx\gx\gx\gx[fw[fw[fwZevZev[fw[fwZevZevYduYduZevYduZevZevZevZevZevXfvYgwXfvXfvYgwYgw[fw[fw\hw\hw\hw\hw]ix_kzaj{bk|cl}dm~engphqjsjvkwlymzmzo|p|q}r~r~sstttuwx||||~zgHjzXz}~}vy{~ıưűƲDzdzȴɴɴɶ˷̷θ϶˵ʷζ͵̵̵̵̴˴˴˴˲˲˲˲˱ʱʳʳʳʳʳʳʲɲɱȱȱưŰűƯƯƯƮŮŭįĮﯯįĭĭīīĩ©©©«}~~{yw}tzrxrxtzpv\bo&,9 &328E39@39@6:?7;@9;@:~F*$~{y y w u t o n k j i g e c``___`abcdghhijklmorsuxz|| | }  '!vr l l[say8LO0n8_|HodznĴò³³IJò²²%%%%%%%%%'''''''''%%%%%%&&&'''(&&*((*+(-.+///,,,&&&!% "($$)%%%%%&&&&&&%%%%%&&&'%%&&&'%%%%%%&&&&&&&&&%%%%%%&&&#'&#'&"&%"&%#'&#'&$('$('$'($'(''(''(%()%()$('$('%)(&*)((('''''''''''''''&&'''(&&'&&''''((((((((((((''''''&&&&&&'''''''''((((((***,,,...---''(##$  " #"""""#$!%'$&)&(((()))))*++,++,,,----,,,++,++,++,,,-+*.+*.,+/-,0*,0)+/(*.(*.(+,(+,******)-,)-,)-,)-,)-,)-,),-(+,(*.(*.,+/,+/,,,,,,,,,******)))))***+**+**++++,,,)-,*.-)+/)+/)+/)+/,+/,+/+*.*)-+*.,+/,,-../'-,$*)"'(#()),-+./+/.+/..-10/31/520641:<9BBCKIJRKMWMOYKQ^MS`KS`LTaLTaMUbKS`KS`NTaOUbMUbNVcOXcOXcOUbOUbOTdNScNTaOUbJTcS]l_m|tezBWf8McJ_ur~|yt|nvfn{emzakz`jy_ix]gv]fw]fw]fw^gx[fw[fw[fwZevXfvXfvXfvXfvZevYduYduYduYduXctYduYduYduYduYduZevXfvXfvXfvXfvXfvXfv[gv[gv[gv\hw[gv[gv[gv]ix^iz_j{`k|al}dm~engphqjtlvlylymzmznzp|s|t}t~t~uuuvwxyy{||~SrFewn{zxz{~ŰŰűƲdzȳȳȶɷʵ̶ͶͶʹ˴˴ʹͳ̵̵̵̳ʴɴɵʵʴɴ˴˳ʳʳʴ˱ȱȱȱȰǰǰǯƱưűƱưŰůȮǭĭįĮðűƮîí­­ĭīīīĪé¨~|zx~v}t{syrxw}pvZ`m)/<!.28E39@39@69A69A7;@8k{'m%kllmklmnmos{5"w#\rSi9Xd;ZfEblA^hG^@W\~?}-(~yx w v t s p n m j h g d c` _ ^ ^ ^_```bdfgiijiknpruxz {| }~~   .1@#kE[ Rh+Yo-[q"^r \p*vAQ:xFmDk\uj¶Ųóij³²³¸ǰ$#'%$(&&'&&'''(''(%$(&%)%$(&%)'%%)''+++,,,+/.)-, %( ##%!!)$&)$&'$&'$&%$(%$(%$(%$(%$(&%)%%&%%&%$(&%)%%&%%&"&%#'&"%&"%&"$("$($'(#&'$('$('#'&#'&&&'''(''(''(''(''('''''''''(((&&&'''''(''(&%)&%)&%)&%))&()&('''(((''''''$('$('''''''''''''&&'(()))*,,-+./*-.$&*!#'####"#"##"#"#"'!&)#(+%*)(,)(,***+++,,,,,,---,,,,+/+*.*)-*)-+++,,,,,---.,+/,+/').').(*.')-'+*)-,),-*-.,+/,+/+*.,+/+*.+*.+)/,*0-+1-+1,+/,+/,,-**+**+))*'*+'*+(*.(*.(+,),-)-,)-,)+/)+/+)/,*0,+/,+/+*.+*.+*.+*.*-.+./&.."**!(+!(+',-',-,.2,.2+-2-/40-62/841::7@FEIMLPKNVNQYKQ]LR^MS`MS`MS`MS`MS`MS`NTaNTaOUbOUbOUbOUbNTaNTaOUbMS`NScMRbJTcYcrp~rTfv1CSK]uew{wq{lvencl}`iz_hy^gx]fw\ev]fw]fw]fw]fw\evZevZevZevYduYduYduYduYduYduXctWeuWeuVdtVdtXctXctZds[etYetYetXfuXfuZevZevZevZev[fwZev[fw[fw[fw]hy^jy_kzakzbl{emzfn{hp}jrlrouowpxnxoypzq{u}u}v~v~t~t~t~vyzzz|}|}vXsIofzzvy{įȱȱȳʳʳʳʶ˶˵̶͵ʶ˶˷̶˶˶˵ʶ͵̵̵̴ɴɲɲɳʳʲ˲˲˲˱ʱʱʱʱʰɲɱȱȱȱȰǰǰǰŰůįįįİůĮîîîîŭĭĭĭĭĬëªé©}~|xv~u}s{qypxqyltX`m*2?"/17D57C46B68B68B9:B:;C8B7@D/DF2GI8grS7@2;;T]G`i;Zl#BT>cFu9/yyw y x v s p m j h f ed ` _ ^ _ _ _ _ _ _ _`acghhilnoquvyzz{||  6:E|.e9Sf2L_=Md?Of4Zr2Xp(fAR?}LsAhYuj{ôű´ƵdzIJñ±²ôű"$("$("$("$($&*$&*%#)%#)&%)&%)"$(#%)&+,(-.*/0',-"$("""!%$$%%%&%$(%$(!&)!&)!&) %( %(!&)#&'"%&"%&#&'"%&"%&"%&#&'"$("$("$(#%)#'&$('#'&#'&#'&#'&&&'''(&&'%%&#&'$'($('#'&$('%)(#'&$('$&*$&*#%)#%)$&*#%)$'($'(#'&#'&#)(#)(!*(!*(!'&"('$('$(''&*('+)(,,+/+-1*,0%'+!%######"# $" &&$*(&,$)*$)*$*)%+*(,+)-,++++++(*.(*.')-(*.)+/)+/)+/)+/)+/(*.(*.(*.'*+(+,),-),-)+/)+/+*.*)-+)/+)/+)/,*0)+0)+0)+0)+0)+/)+/++,**+&*)'+*%*-%*-%*-',/),-),-)-,)-,,+/,+/,+/+*.,+/,+/,+/+*.),-),-(-.)./(-.%*+"'*#(+%*-(-0)-2)-2*-5+.6-08-08-3:5;B26H27@49B4:A5;B5;@6B4AE(BH,FL6gy9j|"k!jjjklmmlnot|%(vEe%" "*5$8C3Rl'F`AhT2H,JR3QYDYhNcrBd|Bd|&f6vF?Ju@k`ymİñűŰðñ±±µƷ¬ %& %& %(!&)%',$&+%#)%#)$"(%#)%$('&*'*+*-.)20%.,%(" !#" &%#)%#)"$("$(#%)"$(#%)$&*#%)#%)#%)"$(#%)#%)"$("$(#%)#%)#%)"$("$(#%)#'&#'&&&'%%&&&'&&'''(''(#%)"$("$("$(#%)#%)$'(#&'#&'#&'&%)&%)&$*%#)#%)$&*$('$('#'&$('"('#)(#)(!'&"('"('#)(#)(%()$'(&(,)+/).1(-0"&+ %%%#######" &%"+(%.$),%*-$*)%+**+(*+(***+++*)-*)-(*.(*.(*/)+0+)/+)/,*0+)/,*0,*0,*0+)/,*0,*0+)/+)/+)/,*0+)/+)/+)/*(.*(.+)/,*0,*0+)/*(.*)-*)-'*+'*+%*-%*-&+.',/',/',/),-),-)+/)+/,+/,+/),-),-),-(+,(,+)-,*.-+/.(-.%*+!(+"),(*.)+/*,1+-2*.3+/4,/7-08/386:?>DIDJOGOVHPWIO\IO\KP`LQaMRbMRbMS`MS`MS`MS`MRbMRbMQcMQcLScLScHUaER^=KZJXgl~p_s3GY8Kf_r|~zt}jtcmzal}`k|]hy\gx[fw[fw[fw[fwZevZevZevZevYduYduYduYduXctXctWbsWbsWbsWbsWbsWbsVarVarWbsVarWbsXctXctXctUdwTcvUeuUeuYduYduZevZevXfvXfvXfvYgw[fw\gx\gx^iz_kz`l{`mybo{fphrislvkwlxnzo{p|q}r~r~t~t~t~uwxxxvvzz}lNh}Jlpvyy{|DZưDZȲʳ˱ʲ˲ɳʴ˴˵̵̵εβͱ̱̱̱ͱͱ̱̱̱̲ͱ̱̱̲˱ʲ˱ʱʱʱʱʱʰɰʯɰʰʯɮȱȰǯƮűƱưǰǯįİŮîŮůůŭŭũũũũũ¨|zut~r|pzpxowu}ksW[m)-?'+=26H2:A3;B2;?2;?3<@3<@3;B5=D2?E5BH'AG3MS5iz8l}#k"jlkmmnmlmov"$&pPVw~Del4=;%.,?CHFJOFMVGNWHM]IN^KP`LQaMRbMRbMS`MS`MS`MS`MS`MS`MRbMRbKS`LTaGT`;HT?QaWiy}k}=Qc8L^[mv|yqyhucp|`k|_j{^iz]hyZhxYgwYgwXfvXfvXfvZevZevZctZctXctXctWbsWbsVarVarVbqWcrVbqUapUapUapUbnUbnU`qU`qU`sVatWbuWbuVbqWcrXdsXdsZctZctXdsYetZfuZfuZfu[gv[gv\hw]jv^kw_lx`mydn}fphrjtiulxmynzo{o{p}q~t~t~t~t~uvtuuuxy|}o6Wk]~}~}}ȴɯưDZȱȲ˲˳ʴ˵̵̷̷̵̴˳γβͲͲͲͳβͲͱ̲ͱ̱ͱͱͯ˲̲̲˱ʱʱʱʱʳʲɲʲʱȲɱȱȰǯưŰŰůįįįƮŭĭĭĭīīĩĩĩ©§§|zvtr}p{nynyynwW]j/5B),:36D39@39@1:>09=4:A4:A5;B7=D2?E5BH#?G2NV-cz2hkjkklmlllnrx"-zq䬰w{zr|.Ph%G_U3r!z yyw v u u s n l h fc _ ^ Z Z Y [ [\] ] ] [ \ _``bdfghmo qtux}}~  Fh޾팳btw:LO7G5Ue3j8o s'z;-{88B::D6=F9@I0FQ7MX=j?l*i+j$k#jmmmmmmry#&He6FhOe : "Q1`K2br"x{z{ y w v t ts q kh c_ ^ \ [ Z X YYYYY []`acddffhjloquvz|~ dU0]ԬهFWr&Z:n3:H-u+Xw-Zy\vlŲıDZDZűű±²õƳ%%&%%&%%%&&&))*(()'''%%%%$(%$('&*)(,)+/,.2,21*0/$*)#"! $"%&"%&%%%'''%%%&&&&&&'''''''''&&&&&&%%&%%&&&'''()))((('''&&&%%&&&'''(''()(,)(,%'+%'+$'(%()$('#'&$('#'&"%&"%&&&'''('''&&&&&'&&'%$(&%)&&'(()((('''''''''''(''(&&'''(((('''%)($('$('#'&%)()-,...---''' ""      !!!####'&&*)%*+%*+'*+&)*(,++/.'0.&/-%.,%.,)-,)-,+++***,,,---,.),.)+++***+++*****+))***+,,----,,,,,-,,-+*.*)-,)-,)-/*,/*,.**/++++++++++++++,,-,,-,,-**+*)-+*.**+++,++++++,,,,,,,,-,,-,+/,+/++,,,----///*0/%+*"'($)*+++,,,-,0-,0,+//.20.41/5.276:?=CHCINFMVGNWHP]IQ^GQ^GQ^GQ^IS`KT_KT_KT_KT_KS`KS`KS`KS`ISb7AP*:Jaqxr*CTB[lj}{~ypxhp}eo|bly^jy^jy^iz]hy[fwZevZevYduYduWbsWbsVarUapUapT`oR^mP\kNZiMXiHSdE[ADYADYCF\;>T3:P29O1@T8G[8:?9:B9:B3=E7AI+FP:U_@k?j-i-i&k%j"l"lmllknw&.'!p;n#[/gRy,f#y+|{{ { z y w t s r o kg c_ ^ ] \ Z X X XYYY Z [ ^ ^_``abegimostxz} !n=ubcd$=*mAC?D&kNp SuVtiDZDZDZDZıı±´õĶ"%&"%&&&'''())*(()#&'"%&%$(%$(''((()(+,*-.+2.)0,$*)"! !%%%%%%%&&&'''&&&%%%%%%%%%&&&&&&&&'&&'%%&%%&'''&&&''''''&&&&&&%%&%%&&&'&&'''(''(''(''(''''''&&&&&&&&&&&&&&&&&&''''''(()&&'&%)%$(&%)&%)(()(()$'($'($('$('$'(#&'&%)&%)''(&&'&&'&&''''''''''+++--.,,-&&' !"#""!"  !!"##$"$(%'+&(,&(,%'+')-),-,/0)/.(.-)-,(,+(-)(-)***,,,,,-//0...,,,++,,,-,+/+*.+*.+*.,+/.-1--.++,(*.(*.')-')-)(,)(,,)+,)+,)++(*+++***++++++++,++,*)-*)-,)+,)+-*,-*,-*,.+-++,++,++,,,-,+/,+/,+/,+/+./-01,0/'+*''((()*)-,+/-,0-,0-+1/-3.05/16,274:?=CHCINELUGNWFN[HP]DQ]ER^GQ^HR_JS^JS^JS^JS^JS^KT_IS`IS`AM\,8GIUjwVgu=N\^o}{u{jrfn{cm|akz`iz`iz]hy[fwZevYduVdtUcsUcrUcrSapR`oN\lKYiIWgFTdGReDObCN_BM^?L_?L_12@/3804927:49<6;>7A3>B7BF'DN5R\7j}7j}(i(i$k#j"l"lnmlmqw&~"u*}77*%}} { { { y x u s p m jf d` ] [ Z X W W Y YYY XZ] [ []^^`bgiknqsxz~  .kk(o4{8D>6A&mLnQsRrh°ñııı±³³¶õµ"&%#'&$('%)(%()%()&%)%$(%$(%$('''(((***---+10)/.))##"!%%%&&&'$)%$)%#(#"'"%%%%%%%$(&%)%$(%$(%%&&&'&&&&&&&&&&&&&&&%%%%%&%%&''''''''''''$'(#&'$('$('#'&#'&''''''&&&&&&'''(((%)($('%'+$&*$&*$&*$('$('#'&$('$('$('$('#'&&%)&%)'&*'&*&%)'&*'&*('+''(++,---,,,!&'"#%%#""" ###%$(('+(&,(&,('+*)-,,,...---,,,,,-++,+++++++++,,,/,.0-/0-//,.+*.+*.,,-++,***+++,,---.,,,,,,(+,(+,(*.')-*)-*)-*)-*)-**+**+**+++,+*.*)-*)-*)-+)/+)/+)/+)/+)/*(.-*.-*.-*,-*,******+++++++*.,+/../001+/.%)(('+('+++,,,--,0,+/-*3/,5-/4/1613779=?DEDIJEMTGOVENYFOZFP]FP]HP]IQ^JR_JR_JR_JR_KS`KS`KT_ENY18IGN_lw]p~/BP_mt}qwgo|dlyaj{`iz_hy^gx]fw\evYduXctWcrUapWdpWdpQ`lL[gJXhESc@M`=J]>I\>I\DO`EPaBRbCScAScBTdBTdBTdCVdDWeBXcDZeC[hC[hCZiCZiE[hE[hE[hE[hA[h@ZgA[h@ZgCXgAVeEScCQa=HY;FW9GW>L\N[gR_kYfr\iu_ivakxemzgo|jrltnvpxqzs|t}u~v~v~v~v~v~wwxwxyz{|[k{Xo|~ty|{жȴƳȴɴɵʴ˵̶϶϶ϵεεηηζͷε̴˴˴˳̴ʹͳ̲˲˲˳̳̲˱˱˲̱˱ʱʱȱȱʱʱʱʰɯȯƯƯƯƮůưǯƯƮŮŭīīīīīīĭĭīīīīĪ驪è}||{wtq|oznynyx~msWYe02>2.;62?35:46;0::1;;3A5>B5>B1>B3@D*HP1OW7l8m%k&l l l l!mlllnqw "%*% ~ } | | | | z xt p n k h c_ ]Y X X X X Y XXX YZ[ Z~Z[]\`bgikmosux}  )+)&)(0+>)s#RrNnQqhŷƳ³³³³³ijĶ÷ĸ &%!'&$'(%()%()$'(&%)%$(%%&&&'&&&'''***,,,,0/*.-%()!"!" &%%&%%&&&&%%%%%%%%%$$%%%&%$(%$(%$(%$(%%%%%%%%%&&&'''&&&&&'%%&%%&%%&&%)&%)#%)$&*$'(#&'$'($'(#'&$('$('$('&&&&&&''((()$*)#)(#()"'(!&)!&)"'("'(!'&!'&#'&$('#&'$'($'(%()$'(%()%()$'($'($'())*++,...,,,'''"""""""""! $#"&%$('&*%'+%'+&)*'*+(+,(+,*)-+*.++,**+++,++,**+,,-,+/,+/,,-,,-,,,++++++***,)+,)+,)+.+--++-++,,-++,+*.+*.')-')-(*.')-**+**+++,++,+*.*)-)(,+*.+)/+)/,*0,*0+*.+*.++,,,--++-++***+++++++++,,-,,-+/.-10+/.&*)&&&((('*+),-(,1(,1(+3(+3,05-16)261:>:CGAJNEMTGOVGMYIO[GO\HP]IQ^IQ^IQ^JR_IQ^JR_JR_KS`IQ^/7D!4nyr>QeIaAK`CMbBP`EScBVaDXcEYdEYdFZeG[fJ\fJ\fM]gN^hO_iO_iN`jOakMalMalMbkLajN`jOakM_jL^iN\kM[jK\jJ[iI^gG\eG[fFZeFYgN^7GW?J[ITeV^r\dxcl}cl}dm~foiskulymzo|p}q~q~t~t~t~t~sstuwwxz}WpTm~~pϴɲDZȲɳʳʵ̶ͶͶͷζ͵εζϵεδʹ˴˴˴˴˴˵β˴˵̳̳̳̲˱˱˲˱ʱʱʱʱʳʳʲɳʲɲɱȱȱƱƱưŮŮŭƬŬŬūīĬŬŭĭĭĭĭĭĭĭī~|{xvs|r{pzpzvjt{PW`,3<21>43@46;57<48=6:?5;@6B6CG)GO5S[:o9n$l$lmnnnmllnnu ~ } } { { {{ y x u r p ni d a ]Z Y X X YX W~ VWXX Z~ Z~ Z\ \ \ _adfhjjlpt{|~ "7"t!Sq!SqYwl±±³³ijĴôöøź%$(%$(&&'''(''(''(%$(%$(%$(%$(%$('&*))*,,-//0--.#()!"!!"&#%'$&'%%'%%'$&'$&&&'''('''&&&%%%%%%%%%%%%%%%'''%)(&*)$('"&%%%&%%&#%)$&*!&)!&)#&'$'($('$('''''''''''''&&&&&&&&'(()&*)%)($('#'&#%)#%)&%)&%)%%&%%&&&&&&&&&&&&&'''(((&*)%)(&*)%)(%'+%'+&(,')-,,-,,-'&*"!%##!"!"!#!#!"!"# $$!%%$('&*('+('+'*+&)*&)*&)*))***+*)-+*.+*.+*.**+++,-++-++-++-+++++******)))))))))+)),**,**,**++,++,,+/+*.(*/').')-')-&*)'+****,,,++,**+*)-*)-+)/,*0,*0,*0,*0+)/,+/,+/,,-++,***+++***+++,,-,,----///../))*&%)'&*))*,,-,*0,*0-+1.,2-/4.05.2759>=CHCINENRGPTGNWHOXJP\KQ]JP]KQ^KQ^KQ^KQ^LR_JR_JR_=GT.8ECNaO]mGVq\k~w}ltemz`l{_kz_kz]ix[fwYduWbuWbuU`qQ\mLWjHSfDObAL_>I\?J]BN]FRaET`GVbEYdG[fE^hF_iF_iG`jIblJcmLclMdmNenPgpRfqQepRfqRfqQgrQgrPfqPfqQgrRhsPfqPfqQdrObpLboLboKalJ`kK_jJ^iK]hJ\gHWcET`EPaAL]DObFQdMYhZfuakzdn}holsnupwoypzr|s}v~v~t~usstuwxz{~nDZms{vewϸʹɱʲ˳ͳ͵ζϵеедϳδ϶ϵδʹʹʹʹ˴˴˴˷ε̵̵̳̳̳̳̲̱˲̱˲˱ʱʱʳʳʲɲɲɲɲɲɱȱȱȰǰǰǯƯƮŮŭƬŬŬŭĭĭĭĭĭīīĪĪĪĩè§~}~|wv~s{qypzpzt~hrzLT[.6=+/415:26;37<48=48=58@8;C636>46@68B5;@6MY=KZ@N]Tamcp|ownvkunxlyn{q{r|t~t~t~uvwyyzzz}~~17>07@29B4=A5>B0@C2BE/LV?\f3l0i~#k#k l!mmlnnqqu{  ~ ~ | { y x v uq n l gc ` ^ Z~W{ S SU~VWzWzWz Vy T|U}U~WVW XY []bdfimps!x|"   (";gJ^?kftɴóųŵƳijijĸǷƳ%%%%%%%%%&&&''''''#'&$('"&%"&%%%%'''()&,-*/0--.+$*)$# "% "'"$)%%*&&&&&&&&&%)&%)&%)'&*&&&'''((((((((()))&*)&*)#() %&!&'!&'"('"('!'&!'&!'&"('$)%#($&&&&&&(%'(%'&&'''('(%&'$&'$'(%''''''&&'&&''$('$()&*)&*&&&&&&''(''('&*'&*(()(()(()(()(()''((()++,---...'''###""! ! !!"! ! "!$# $$%''((()))*))*))***+++,,,-++,******)*')*')))((())*,,-)+/(*.(*/)+0**+**+))))))***+++***)))+)),**,**+))+)),**,)+,)+,)+,)+**+**+**************+**+**+**+-++,**,**+))+++***+++,,,+*.+*.+*.,+/,+/.-1-,0)(,&&'''(+++,,,*.-)-,*,0,.20.420621598/5:06;26;37<37<59>4;>7>A2A@3BA1RW=^c-h~/j%m#k$k$kmlnnoou}  ~ | { z y x u r n l f c`Z XV~ T|U} T| S{S{T|T|T|S{U}U~VVWX}Y~Z\`aegknq u!z#|! .(=Y}9QDjkwµ´ųŴŴŴŲ÷ķij%%%'''''''''#)(#)("('"('%%&%%&%%%&&&))),,,,1-+0,%-''!!!!$#'!&)#(*$)&%)%$(%#)&$*#%)$&*$'($'('''''''''(((((((((''(&&'$('$(' )' )' '*&)"'*"'*$('$(''''''')&((%'&&'''('(%'(%'(%'(%''''''&&'&&'%%&%%&&&'&&'&&'''(''(''('&*'&*(()(()(()(()(()''(((),,-......((($$$ ! !  "!#"# # & ' !)#(+%*('+)(,))*++,),-+./'0.%.,&,+$*)******))))))),-*-.(-.',-(*.(*.(,+'+*))))))******+(*+(*+)),**.**.**+)),**,)+-*,-*,-*,**+**+**+))***+++,+*.+*.*)-*)-***))),**-++/++/++-*,-*,,,-,,-+*.,+/)+0+-2+-2').#%)%'+(+,),-.-1-,0-,0/.2/-31/5206:8>?CHEINBLTEOWCMZEO\GQ^GQ^IQ^IQ^IQ^IQ^HP]HP]8>R3ox?L_/>Wx|tzhp}dlybl{`jy\gxZevXfvP^n1FU-BQ5GY8J\DO`LWhO\hS`lVeqYhtYkvVhsVjuWkv[jv\kw^my^my^my\kw]jv]jv_iv`jw_kz^jy]jv]jv]jv]jv]jv]jv^kw]jv]jv]jv`jw`jw_lx`my`my_lx_lx`my`my`my`nx`nx`nxdr|br|^nxXnyUkvViwTguWfrTcoRamN]iAO^1?NFQbVaremzownvpxqyt|u}u}uvuvxyzz}o}dysewuӻԳɳɲʹϵдϴϴϷж϶϶϶͵̴˴˵ʶ˶˶˵ʵʵ̵̵̴˵̵̵̵̵̴˵̵̵ʹ̳ʳʳʳʳʲɲɲɲʱɰDZȳȳȳȲDzDZƱưŮŮŬŬŬūīīīīīīīĩ©©©¨~|}{wuro|n{mzs~cnyGMZ*0=&(202<24846:57;57;68<79=7A3AC5CE4Q[B_i6i6i'i'i#i#illnnmlry   } | z z x u s o l gc `[ X V}U} S{ S| R{R|S}V{TyT|S{R|R|T~T~V~WYZ\_behjosw| ,&<~ Os3MHkoxijıijƲïõ²%%%&&&$('$('%)(%)(#'&#'&%%&%%&&&&'''***,,,//////%-''! !""!%%$(&&&&&&#%)#%)#%*"$)#%*$&+$&*#%)$'($'((((&&&''''''&&&&&&$('$(' )' )' (( (("'*"'*#&'#&'&&&'''((('''&&&&&&'''&&&$('$('$('#'&#&'#&'&&&&&&#'&$('$('#'&&&&'''''(''())*))*))*))*%()%()'*+),--10,0/)))$$$"#!"! ! #"#""!#"$#& %'$(*'+*)-*)-'*+),-)./*/0(00%--(,+'+*********+,,-'//'//(-0',/(*.)+/,,,+++******+++***++,**+**+**+*********+++(+,(+,(*.')-*********+++')-(*.)+/(*.(+,'*+++,++,++,++,,+/,+/++,,,-,,-,,-)+/)+/+-2-/4+-2').$&*%'+(+,),-*,0+-1+-2+-2,.3.050278:?;DHAJNBOUCPVDN[EO\FP]GQ^GQ^GQ^JR_JR_IR]GP[%.?,5Fjw@DIEINCMTEOVDN[EO\GQ`FP_IQ^IQ^JS^KT_HS^>IT&6FP`pm4HZFZlxw}ntio|dlyckx`jy]gvUeuDTd*@S*@SAMbKWlWan^hu^kw[htPdoOcnQcnSepXeqYfr[gv]ix]ix^jy^jy^jy_lx^kw^kw^kw^kw^kw^jy^jy^jy^jy^kw]jv]jv\iu]jv]jv^kw^kw^kw_lx_lx^kw_lx_lx_lx_lx`my`my`my`myanzanzanzcp|cr~ds^t]sYq~Xp}Sm{PjxNgxKduF^q6Na+AS7M_go|u}v|u{s{t|v~v~xyz{||}~ǓYuhk~PcyŸ޹ζ˵εεдϵεεδʹͳ̳γε̵̴˴˴˴˴˵̲ͲͲͱ̳ͳͲ˳̵̵̵̴˴˴˲˱ʱʱʱʰɰɰɲɲɰDZȯȯȯȮǮǭƯƯƯƯƬūĪŪũĩīīīĪì~|zxv~u}s|qzpypyx~flxEJS).7)3:)3:-6:-6:46;46;57<79>9;@:7;@8/X`L[T^kist}u~t~utvxxxyyz}}Šrmٴη̸ͷззηηηθ͸͸ͷ̶˶˶˶˶˶˵̵̶͵̵̵̴ʹʹͳ̵ʴɵ̵̳ʵ̳̲˰˰˰˯ʰɰɰʰʲʱɱȲɰɯȮŮŮŭĬë«īī«««««ªª~|{yxv}t{ryrypwveow=JP+8>-9;*68/4716975;86<68=79>8;C8;C1>B1>B2Ya>em1n0m$k$k lklkmmmnt}#$ ~ | | { w t mh b^ XU Q{ Q{ Rz RzRxRxSwSw Rs RsSwSwTuTuSwSwTuVwVwUvRxRx OyQ{WZafmqty|  0,@~Yz+PePuq~±±±¯įį¯±³ĵĬ%$(&%)''(&&'%%&&&'''(&&'%%&%%&)#(+%*,((0,,1//0..***###! # $'$('$&(%'(%')&()'')'')(%*)&)''(&&)''*((*((*((+&(*%'(%)(%)%%&%%&&%)&%)"'("'("'(!&'#'&$(''''''''''''''''&&&''''''%%&%%&%%&%%&''((()%()$'($'($'(''(''(''(''(''(''(('+('+''((()(()''(('+,+/0.40.4)&/$!* &%!"!""!! # # % "(#%'$(*'+*)-+*.(*/').(*.)+/,+/+*.+*.*)-***+++************,**-++-++,**-++,**,**-++-*,,)++)),**,**,****+**+*)-*)-+*.+*.++,**+*)-*)-*(.*(.*(.*(.*(.*(.*)-+*.+++******+++++,++,-*.-*.,)--*.+)/+)/*,0,.2+-1')-&(,')-+./,/00/30/3.05/1602724925=;>FOT]OT]LU`MVaNVcOWdMWdMWdNXeOYfMZf-:FAM\g{$>QQk~žxmsjp|dk{biyYbsPYj;DUAJ[N\lR`pTguTguTfvSeuQfuQfuPetOdsQfuQfuRgvRgvRgvQfuSdrUftZfu[gvT_rJUhIShNXmZfu\hw]ix^jy_kz^jy]ix]ix]ix^jy^jy^jy^kw^kw`jw`jw_iv`jw`jy`jy^jy^jy`my_lx^kw_lx_kz_kzbl{bl{bl{bl{bl{cm|dn}fpdsetbwcxcwbv]oUgwVhzWi{XjzXjzXjzXjzVhzHZl@RdPbtdq}n{t~t~xz{|z{{|~Óeo|ջԺͻιιιιιιιиϷηζͶͷ̶˶˶˵ʶ˶͵̵ʵʵʵʵ̵̵ʵʵ̴˴˳ʲ˲˱ʱʱʰɰɰɲɲɲɲɲɱȲDZƮŭĭƭƬŬŬƫūīĬūīĪêêëĪêêé}~|zxv~t|rzpxpynwt}dmx;EM/9A.;?(59.49/5:46:57;85>:7@9:B;6F6BJ7W`Ddm9o7m'l'l"l"l!k!k"l!klmu ~%   ~ | z vr lg b] XS{ Q{ Pz Qy Px Px Px Oy OyRzRzUzW|X}Y~ Z~[ \ \ ^ ^ ^ ^\ [ X W R{Xd#ip$v}  #*%B*h4]mS|otŲòòijűıııĻȱ &%"('#'&$(''''&&&%%%$$$&#'&#''$('$('&*,+///0001(,+"&% """%%%%%&&&'#&'#&'#'&$('$('$('((('''(((((((((&&&$&*$&*#%)"$(#&'#&'!'&"('")%#*&$)%$)%$)%%*&$('$('$('$('#&'#&'"&%"&%&&&%%%%%%&&&$'(%()"'("'("('"('$('$('$('$('((((((((((((((()))(((((())*,,-.12-01(+, #$"" ! ! ! ! !"!%$#'%$(('+)(,*)-+*.+*.,*0,*0,+/,+/++,**+***++++++++++++***)))***+))+))-))/++/++.**.)+.)+.)+.)+,)+,)+++++++))***+++,++,++,**+)(,*)-**+))*******(,+(,+(+,'*+++,++,+,),-*+,)+,)-++-+++*.,+/+*.,+/--.001/.2,+/('++*.,.2/15.36.36.36/4715:37<06=@FMQ[bQ[bSacTbdScfScfSbhSbhS`lP]iHUaS`lq~_q/AQuu|nu~akxblyZevAL];EZEOdR^sXdy[lzZkyTjwRhuRhuRhuRhuSivTguUhvTguTguTfvTfvTfvTfvTguUhvWkvXlwWkvWkvXjuXju[ix\jy]kz]kz]kz]kz^kw_lx^kw^kw`jw_iv`jw`jw`jy`jy_ix`jy_ix`jy_lx_lx^kw_lx_lx^kw^jy^jy^jy]ix]ix]ix`l{am|^o}`qbtbtbvcwcyawZp{VlwVjuVjuWkvXlwYlzYlzYk{Yk{VhxPbrNbmL`klzsv~xxyyzzz}~Ʃ|j{һϹ͹йкѹзззжϵ̵̷̶˶˶˷̶˶˶˶˶˵̵̵̵̵ʵʵʵʵ̴˳ʳʳʴ˳ʳʳʳʲʲʳʲɱȱȱȰǯưǰǯƯƯƮŮŮŭĭĭĭĭĭĭīīīª~|ywvt~r|q{pzpz_ip7@K/8C18A.5>-69.7:/99/991;;2<<4-4=39>06;-38/5:17>39@4:A5;B5=D5=D.>H1AK0Yh;ds-m-mkkkllkkjjmt}   ~ { y to fb \X S| R{Qy Ow PxQy RzT|W|Y~ [}\~ [] ^ ^ ] ] ^ ^ _ _ ^ ^ ]_ ^ ^ _`cehoz 63NAyRr{bv}ðűıı±±±±±·± %& %&%$(%$(&%)&%)!%*!%* %( %( &% &%!'&%+*'0.)20%.,'% """$$$"&%#'&"$(#%)!&)!&)"'*"'*#(+"'*#(+#(+"'*#(+!(+ '*!(+&)%(%(&)&)'' ((#)($*)$)%$)%#($#($#'&#'&#'&#'&#'&"&%#'&$('#($#($!'&"('!&'!&'!'&!'&"('#)(!*( )' ((!))!(+ '* '*!(+"'(#()$)*',--23-23',- %&!$ ####$## $#!'%$(('+&(,&(,%*-%*-*)-*)-**+**+*********)))))*))*))***+**+**+*)-*)-*)-)(,)(,*)-*)-+*.+*.+*.,+/+*.++,**+,)++(*+)),**,**,**,**,**********+**+'*+'*+'+*(,+'+*'+*********+**+**+++,*)-+*.+*.,+/*-.-01+01',-#*-%,/(14+47-69-69/6918;6:?8.7:,58-6917<39>4:A5;B3;B5=D.B0?E3BH4Ze?ep,k,kklmmlllmmnu   |y to d` XU R{Ox Nx OyRzU}V~X [ [ \] _ ^ ^ \ Z [\\]] Y ZZ[]ZY[]_agow  2.QE{Wwcx¶ų±űűıııĺŮ%(%(!&'$)*#)(!'& %&!&'#'&#'&#'&#'&$(''+*---000,,,&&&!!!$$$ &%"(' %& %& %( %(!%*"&+!', &+!(+!(+!(+!(+!(+ '*"'*"'*#'&#'&"&%#'&$('#'&%'+$&*%()%()'''&&&&&&&&&%%%%%%%%%%%%&&&''''''&&&#'&#'&"&%"&%"&%#'&$('$('$'($'(#()"'("'*"'*"'*#(+$),$),%).'+0001445---%%%! $"!"!"!" ! !!""$%!'%#)'%+'%+(&,)(,)(,)(,)(,)(,*)-*)-+*.++++++******))))))******,,,,,,,,,+++********+++,,,-++,+*.+*.+++++++,)*+(******+++******++++++***********+))*++,++,*)-+*.*)-+*.++,,,-'-,'-,'-,'-,)+/)+/*,1-/4-/3)+/$),(-0-2527:48=48=48=7;@8>C:@E:AJLS\ntlrjrylt{ktxirvjryjry`jrakstdp(4Izǡw}mugo|XcvITg;F_MXqWgw]m}_q|`r}bq}_nz`my]jvYgvXfuTguUhvUitVjuWitXjuYjxZky]k{]k{]k{^l|^l{`n}bo{bo{`my`my`l{`l{`l{`l{_lx`my`my`my]lx[jv[ix[ix]ix]ix[fwZevXexYfyZhw[ix^kw^kw_lx^kw\kw[jvZhwYgv[gv\hw^jy`l{_lx_lx`l{bn}_p~_p~`qbsdvewi{gy\nyWitThsThsTguTguUeuUeuXfvXfvYfyZgzXgzYh{XjzUgwL]kPaoowu}w}x~v~ww~xy{|}ŮǛqվһкϷззззηζ϶ϴддϴϴʹʹ˴˴˵̳̲˲ͱ̱̱̳ͳͳͳͲ˲˴˳ʳʳʲɲɯȰɰɰɱʰɯȮǰǰǮȮȮȮȭǭǭƭƬë«««ªĪêêë«««©~|}{xw~s}r|pzpzoxOXc.5>7>G2;>/8;-77+55/6918;59>7;@7;@9=B1?G1?G3[g@E9>GLQZlrpvlv~nxkwkwivhu^kwhu[mGYkȞ~lrfr`l{-7>13835:87;:9=8:?:w>w ?w@xF{G|LOZ ct4+/"     %=:P~IwXuc{±óıŲƱıĵ¸Żĭ"$(#%)#&'#&'"'("'( (('' %&!&'#%)"$(#&'&)**/+-2.)-,"&%  "#%"&'$((%)&%)&%)#%)$&*!*(!*( )' )'"'("'("'*!&)#%)#%)#%)#%)#%)#%) '*&)&) '*!(+!(+%()$'('''&&&''''''&&&&&&&&'''(''(&&'%%&%%&%%&%%&&&&&&&#'&%)($('%)($'($'($('#'&#'&$('%'+%'+('+('+)'-,*0206317,+/%$("!% # #"""!"$#& %)#(*$),&+,&++(,+(,))***+**+))*)(,)(,)'-)'-)(,)(,**+**+******++++++++++++++,++,+*.,+/+*.+*.+*.+*.+*.+*.,,,,,,,,,++++++,,,,,,,,,,,-,,-,+/,+/,+/+*.+)/,*0)+/)+/),-(+,(+,),-),-),-',/',/)+/)+/-+11/5/16)+0$+.'.1.3438979=8:><:@>>=A@?C?DG?DG5=DPX_tzu{w|w|u~u~t}u~qwU_tBQl~t|emzMWl>H]GOiV^xbm~grivivhufsdp`l{^jy[gv[fwZevXfvXfvWeuWeuVfvVfvVfvWgwYgwXfvWeuXfv[fw]hy]hyZevT_pT_pT_rT_rYcxYcxWdwWdwTbrTbrVdtVdtUcsTbrUcsUcsTbrUcsUcsVdtVdtWeuZevZevXfuZhwXjuWitVjuXlwYmxXlwYmxZny\ny]oz]oz^p{`n}ao~_p~`q`sdwgzbuZkyWhvVguVguTesTesUcrTbqWcrWcrUcsWeuUeuVfvSivVlyVlyVlyRcqQbphrpzt{v}w}w}x~x~z{|}~ʅv۽ӷͷзйѸиϸϻκͷ̶˵̵̳γβͲͳγδʹͲͱ̲βγͲ̴̴̲̲̳˳˳˳˳ʳʳʳʳʲɲɲɲɲɱƱưŰŰŰŰŰŭĭĭĬììí­«īīĪê}|ywv~t|rzpzoynxQ[h!)6.6C17C17C18A07@/7>/7>37<59>7:B9~PMD&%  !91F{@uUr|g|IJõǴƵŸȵ³®%%%%%%$('$('"('#)("('"('!'& &% &% &%&&&***...///'-, &%  $ '##)%%*&&(&&(&&#'&#'&"'("'(#()!&'!&'"'(%'+&(,%()$'(&&&''''''&&&%$(%$(%$(&%)''(''(((('''#'&%)(%)(%)($('#'&&'$'(%((('''%%%%%%"&%"&%"&%$('#'&$('$('%)(#()#()#()"'("('"('#)(#)(%'+%'+*)-,+/222222,,-&&'"!% #  ! ! $#'!&)#(,&+)(,('+&(,&(,*)-)(,+(*,)+,)+-*,**+**+***)))&*)'+*'+*(,+)-,(,+++++++)))++++++,,,**+++,,)+,)++++++++++,,,++,++,++,,,-,,,,,,*.-)-,*.-)-,(*.(*.(*.)+/,+/,+/+*.,+/,,-,,-,,,,,,.+-.+-.,,.,,0..422/23(+,#(+).13766:9==>>>????CCCADECFG8>EQW^uxy|w|y~zyxwu{IQeDNj¨z}nvbjw@N^2@PU`x`kfrjvjwjwhtfrco~`l{ZhxZhxXhxXhxWgwVfvVdtVdtVdtWeuUeuVfvVdtTbrUapWcrZdq\fs^euZaqU_nU_nS_nT`oUbnVcoSaqR`pR]pQ\oT_pT_pR]nQ\mT]nT]nT]nU^oT_pU`qU`qU`qVarWbsXdsYetYfrYfrZgs[ht[ht[ht\iu^kw`my`my`myanzanzcp|cp|er~dsfufycvXfvVdtXfvWeuVdtUcsVbqVbqVbqVbqWcrWcrWbsXctWetXfuYht\kw]jvR_k`hupxqzs|v|w}w}x~zz}~ėؿӹ͹иϹйлѻѻкϹη̶ͷδϳγβͲͲʹͳ̳̳̳ͳͲ̴̲˴˲˲˲˱ʱ˱˱ʱʱȱȱȰǰɰɱȱȱȱȱưŰǰǯƯƭƭƭƬŮŮŭĭĭĭīĪê~{yxut~p}n{o|mzkxP]i(1<-6A0:A.8?19@19@19@19@4:A5;B7:B9>>>>>???CCCCEJEGL;AHTZauyx|{~||~|~~{=H[_gtwhq|S\g39>6:?6:?89A9:B9;@;=B7=B7=B/AK4FP4as:gy'j*m#j$klllnmmnrz     ~zr l `\ Tw TwR|T~VW X X W U T TT R~N}Hw S{Iq]vlij³ijijijijijĵķƸ%%&%%&%%&%%&&&'%%&%$(%$('$('$(%%&%%&''(++,+/.,0/&/+!*&#! #!!&$$%%&''(&%)%$(#%)#%)$('%)(%()$'($'($'(%'+%'+%'+%'+$('%)(%)(%)($('%)(((((((''((()''''''(((((((()(()(()''((((((($)%%*&#'&$('#'&#'&$'(#&'$'($'(%()%()%'+%'+%()%()%)($('$'(%()))*))***+++,112889+./%()"!% # !" !#"#"#"& %%$(('+&+,%*+&,+&,+&+,&+,(,+'+*(+,(+,**+**++++***+++******))),**-++,**-++,,,++++++++++++,,,++,++,++,,,-,,-,,-,,-,,-,,-,,-,,-,,-,+/,+/-,0,+/,,-,,-,,-,,-,,-,,-,,-,,--*,.+-.+-.+-.+/.+/.+/.+/0-/413223,,-++,//0888<<<;?><@?@@ADDEFEIHGKACHXZ_z{|}~~~|~{}q}Zfu}}ou`jw@JW>MaUdxdpgskxlylykxivgteqam|^l{^l{YlzYlzWjxViwUgwUgwShwRgvQhwRixMasH\nLXmLXmP[lR]nQ_oR`pQ_nQ_nOalOalMalL`kL^nM_oM_oM_oL_mL_mJ]kI\jI\jI\jJ\lK]mO_oN^nP^nQ_oQ_oR`pP`pP`pP`pQaqP`pP`pT_pVar[fwal}_m}^l|]m}^n~_p~`qbsctcvfyi|bu[lzWhvXfuVdsTcoTcoVcoUbnTamTamT`oUapT_pT_pSaqUcsXfuYgv[ix\jyYfr\iuqwtztzv|x~x~yz|}~~ȢӾѷηεεηжϷжϸ͸ͷ̸ͶͶ͵̵̵̴˷ζ͵̵̵̵̵̵̴˴˲˲˲˱ʱ˱˳ʳʳȳȳȲDzɲɲɱȱȱȲɱȰǮůƯưȯǯǯǮŭĭĭĭĭĭĬì}|zxvtp~n|n{o|iq~NVc(.:06B4:?39>6:?6:?6:?8B6?C0AG.?E6bp@lz-n-n#j#jlmmmnnpoy!   zs m`Z Uz TyU~XWWVVT SRSP}O|H{ @s4q.k(l&j&f(h*e)d)g)g)i)i+i!-k/i1k3k!6n 6p"8r";t#<@?>@DACGCEJFHM=@HQT\{~}~||\m{nx~hn{Uap?KZN]p^mesiwlylylykxjthrfpcm|`k|`k|Zl|Zl|Zl|Yk{VkzWl{TkzTkzUmz[sThsJ^iKYhJXgKYiM[kL\lM]mL\lL\lL\lM]mK]mK]mL^nL^nL_mL_mL`kK_jK_jJ^iJ]kI\jJ]kK^lM]mL\lN\lO]mO]lO]lP_kP_kO^jP_kO]mM[kP[lWbs`l{co~\p{\p{]p~^q_r_rbsdufwhyk|ct[lzWhvTdtRbrRcqQbpUapT`oT`oT`oT`oT`oR`oR`oPaoRcqTfqVhsZev[fw\ev[dumstzu{w}x~yz{||~ȨļϾѷззззηιιθ͸ͺϺϸϷε̵̳γγϲγβͲͱ̱̱̰˱̱Ͱ̱ͯ˱˱˳ʳʱʱʱʰɰɰɲʱɱɱɲʱɱɯǮȮȮȭǮȬƭŭŭĭī«««««ª|{zwutqo}m{rgo|HP]"*7-5B2;?2;?3<@3<@6B7@D2CI2CI6bp?ky'l'lkkllmmnoooy$!$   {tn `X VU W XVVV U V U~ T} R{L{ Ix?u 6l-n)j$k$k&h&h&f&f)h*i+j+j,i.k.i /j1j!3l!5o"6p#9s$:t#=t#=t!@DACGEGLGINPbw~qz]fqEQ`LXgWfycrhvjxlylynxmwkuhrdo`k|^k~^k~\l|\l|\m{\m{Zm{Zm{Zm{Zm{Zm{`s\kwKZfHUaJWcGWgIYiIXkIXkGYkGYkHZlI[mG\kH]lH]lH]lG\kH]lJ]kJ]kK^lI\jI\jI\jI[kI[kJ\lHZjI[kHZjHZjI[kI\jI\jI\jI\jGYiGYiIWgSaqZhx^l|[m}]o^p^p_r`sdrfthvjxm|fuUftVguSdrQbpRcqPaoT`oS_nR^mS_nS^oS^oR`oQ_nNaoObpPcqQdrTcvVexYfyZgzblymwu~t}x~y{}z{|}}~Ȧֹιεееεηζ͸͸͸ϸ϶϶ϴϳδϳγϳϴγʹͳ̳̳̲ͱ̱̱̰˰˰˯ʱʱʱ˰ʱ˰ʱʰɲɱȱȲɲɱȱȱȱȱȰǰǯǮƮŮŭĭĬë««­¬ë¨~}{xwr~q}p|sdozALW#.-6A0;?0;?3<@3<@6BA?AEBDHHGKIHL?CHW[`wyxz|~bn}7F_|huMZf4FVTfv\o}cvlylylylynxlvivfs`n~]k{\l|\l|\l|\l|\l|\l|\m{\m{\m{\m{\m{arWdpFS_DQ]GT`GSbGSbGUdHVeFVfHXhHYgIZhIZhIZhIZhIZhIZhIZhKYhLZiJ[iJ[iH[iGZhGZhGZhGYiGYiHXhHXhIYiIYiI[fI[fHZeHZeHVeESb=KZKYhWfr[jv]oz_q|_r`s`s`sbtdvfxgyg{auNaoQdrQcsPbrQaqP`pS_nR^mR^mQ]lQ^jR_kO^jP_kO`nPaoPaoRcqVdsWet[gv]ix`huiq~u{x~v~xxyzz{{~}ȫڸϷεεεεηηζ϶ϸϸ϶϶϶ϵεεζдδʹʹʹʹͳ̴ͳ̱̱̱̰˱ʱʱʱʳ˳˳˲ʲʲʲʲʲɱȱȲɱȱȰǰǰǯƯƮŮŮŬŬŬūīīĬìì멦}{yxusqo}p~r_iqEOW$,+5=3;B2:A4:?5;@839>7;@8B5>B2?C2?C,FL7QW6>n>nYvk~²°±±ñõŵų#%)%'+$)*#()"**#++!))'' %( %(#%)$&*%()'*+*.--10+0,%*&##!#' %&"'( )' )' (( (( )' )'"('!'&"('"('"('#)(#)("('"('"(' )'!*( )'"+) )'!*("+'!*&"+'"+'"('"('!'&!'&$('$('$('$('$&*$&*$&+#%*#%)$&*$'($'($'($'($&*$&*%'+%'+%()%()$)*#()#()#()$'($'(%()(+,,/0256,/0%()" &# #"! "!%$'!&*$)+%*)(,*)-*)-*)-++,++,+++***+++++++++++++++,,,*.-*.-'-,'-,),-),-+++,,,+++,,,,,---.,,,,,,,,,------,,,,,,,,,,+/-,0-,0-,0+/.*.-*.-*.-,,,,,,,,---.)+/)+/),-),-),-),-,,---.,+/,+/,+/,+/,+/-,0/.2326.36(-0$,,*221:87@>;@C=BECBFFEIIGMJHNFCLTQZ{w}~`myQcspqINdDI_R\xhrkyjxlylylylynxlvjtgq~bl{bl{`l{`l{^l{^l{^l{^l{^l|^l|\l|\l|\l|ZjzL]k9JXDP ).5>4:?4:?5;@6B5>B2@B/=?*DJ7QW<;@A=BCCBFFEIJFLLHNNHSYS^yt|kun}~jlx7>OLSd`ilukyjxmzmzlylylxjvhreo~^iz`k|^l{^l{^l{^l{\m{\m{Zm{Zm{Zl|Zl|YlzUhvGZh5HV:HWK^5BU?M]ao`o{`o{bq}bq}arbs`s`sbvcwfxhzo~gvVeqQ`lPaoO`nK]mJ\lK[kK[kK\jM^lM_jL^iM\hM\hM[jM[jO]lR`oQcnRdoTfqVhs\kwZiu[htlyyxz{yzz{ֽϹ˹ιιиϹййи϶϶ϷѶжжеϴεϵϴδδʹ͵̶ʹͳ̴γͳͲ̱˱˱˱˱˲̳˳˲ʲʲʲʰȱɱɯDZDzȲȳɲDZƱƱƮůƭƬŪũĩĩĩĩĪ¤~}{ywvtvt}v~w`fsAGT),2>2;?4=A3<@4=A6B5>B1>B1>B(DL7S[4gz9l'l'l!k"llllmno os{!!   |tbW _``` ]Z V UP} Ly Bw9n0o-l+h-j-f+d*e*e)g)g*h*h+i*h)k(j)k*l (k!)l!)m"*n#+n#+n'+l'+l'+l'+l()m()m''m''m''m))o(-l"'f S$]'L{Zb];7"# -/D:DmGpd}o°°²·%* &+#(+$),'*+&)*#&'#&'%$(%$(#%)#%)"'(%*+'-,,21'2)"-$&! "$'(& )'*%*% &% &%#'&$('"('"('!($")%"('"('"('"('"('"('"('#)("('"('!)) ((!*("+)#)(#)($'("%&#&'#&'!&)"'*"'*#(+#(+#(+$)*#()$('$('&&&&&&&&&'''$('%)(%)(%)(%*&%*&#*&#*&#*&")%"('#)(%)('+*,0/154///&&&""# !! # "" !!" #!!&$$%%&))*&,+'-,'-,'-,)-,)-,,,,+++++++++,,,,,,,,,,,,,+/,+/,+/,+/,,-,,-,,,,,,,-*,-*-.+,-*,,,,,,,,,,,,.-*.-*,,,,,,,,,---,,-,,-,,---.---...+/.+/.)./)./&..%--'.*(/+)-,)-,,,-,,-,+/-,0,,-,,-,,---.//0334-25(-0%((14/8;5>A7@C8AD=AF@DIFGOGHPJGQ[Xbut~}xmyx}\aj4;LX_peplwmzn{n{mzlylylykxgtcp|^jy_kz^l{^l{\m{\m{\m{\m{\m{\m{\m{\m{_p~SdrFWe3DR9HT:IU;IY>L\?M]?M]?M]AO_@N^BP`@P`@P`AQaAQaAQa@P`@P`AQaCQaCQaAO_BP`BP`BP`@P`@P`>P`=O_=O_MXfugujxn{n{pzoylylykxjwfrco~`l{_kz`l{`l{^l{^l{^l{^l{^l{^l{]n|]n|[m}PbrFWe5FT9HT9HT;GV=IX>IZ?J[?KZAM\@O[@O[?NZ@O[AO_@N^BM^BM^CN_CN_BP_@N]AM\AM\AM\BN]@N]@N]?M\?M\?M]>L\B0=A3<@4=A7=B7=B5>B6?C1>B1>B+GO:V^7i;m$j&l l lllmmmnpv"   wd` cdgd `[ XS~L{Cr 8q3l/l.k-j,i*g+h+h+h+f+f+f+f,i+h(h'g#)l#)l+i+i+i ,j!+i *h#*i#*i$*f%+g"'f"'f&e!(g'g(h(h*j +m&h [V0hK`[o;7 .,G?TsOni~t!*( )'#)(&,+$-+$-+!,*)' &%!'&"$(#%)$&*(*.)./+01(1/"+)&$! $!#'"&%$('&&&&&&&&'&&'&&'&&'&&&&&&&&&&&&%$(%$('&*&%)''(''(((('''%)($('#'&#'&$'(%()%)(&*)&+'&+'#)("('"('"('"('#)(#*&#*&"('"('$&*$&*$&*%'+%()%()#()#()#()#()#)("('$('$('$('#'&''''''''(++,000777-10%)( "&!%!!"""#!!! !!!"""#%%&$'(&)*%*-',/'+0'+0,+/+*.+*.+*.+*.,+/,,,,,,,,,,,,,,-,,-++,,,-,,,,,,,,,---,,,---*.-*.-*.-+/.*.-+/.+/.+/.+/.*.----...---,,,---...*.-+/.).1).1'.1'.1'//'//)/.)/.*-.*-.,+/-,0--.,,-,,---.,,-../111222-23',-&+.+033898=>=@A>ABB@FFDJIGMJHN?AKUWayz}~}z\l|oZhr>LV?Ve\si|h{q{q{pzpzlxlxkwiufr`l{_kz_kz`k|`k|`l{`l{`l{`l{^l{^l{]n|^o}^o}QbpIVb>KW:HR9GQHW?IVAKX@MY?LX?LX?LXAJ[AJ[BK\AJ[AL]AL]AM\?KZ?KZ?KZ?KZ@L[?KZ?KZ?KZ=IX=IX=IXB7=B7=B5>B6?C2?E2?E,GQ:U_5j9n%k%k l lmlmllmnt"  {f_dekf _Y WR} HzAs 7r2m/l.k-k,j,j+i,i+h,f,f,g+f+i*h (k'j$(k#'j!(h!(h")i")i!(h")i!(g")h$)h$)h!(g")h!(g!(g 'g 'g'j'j"(k$*m##k^RbAcrUO,,!-+F=~QpNmg~sð®&&&&&&)))+++'-,'-,'+*#'&%%%%%%&%)&%)%'+(*.(-0+03*0/&,+ %! !!%#!'$#'&%)(&&'%%'$&(%'&&&&&&&&&%%%&&'&&'&%)&%)('+('+''(''(''(&&'&&'''(''(&&''&*('+))*))*)))(((''''''&&&&&&&&&(((((('''&&&&&&(()''(%()%()#)(#)($*)#)(%)($('''(''(''(''('''''''''((('''+++000888000'''$#'! $!!" !   !"!%$#'%',%',').(*/*(.+)/-)/,(..'.0)0,+/,+/,,,,,,,+/+*.+*.+*.++,,,-,,,,,,------------------../../...---../--.-,0,+/,+/-,0,+/-,0------,,---..-1.-1.-1.-1*,0*,0(-0).1(-0',/,+/,+/--.--.*-.*-.*,0+-10/3326/23+./(*..0457<;=B?=CA?E?@HBCKGGQHHRA@NYXf~}~}~^k~|ŸFS_?LXVfvhxq}o{s{s{s{rzoynxmwmwfp}`jwakzakz`k|`k|`l{`l{`l{`l{_m|_m|_m|ao~cp|S`lFT^9GQ:CN9BM7AP9CR:CT;DU:FU;GV;GV;GV;GV;GV;FW;FWGX>GX>GXI/JT;V`4j{8n#l#llmllllllow!  ~ k^ e eg e` [ XQ|Fy?r3o1m.l-k*l*l)k)k*i)h+h+h+i*h(j(j"(k"(k"&i!%h!%h!%h!%h"&i#'h#'h#'h"&g#(g$)h!(g!(g!(h 'g"&i"&i!$i#&k$'l$'l$%o!"l] V3fRkemE?'+2/F=~LlQqit'%%(&&)*',-*)-,)-,'*+$'(%%&$$%'$&'$&(%)+(,--.//0(00#++%( ! # "("')#('$&)&(&&&&&&&&&&&&%%&&&'&&'''(''((()(()(()&$*&$*%"+&#,)&*)&*)&*(%)(%')&('''(((()&'(%'''''''''&&&&&'(()(()(()&&'''(&&'(()((((((%)(%)(%()%()(()&&'''(&&''&*'&*)&*)&*(%)*'+(()++,001445+03%*-"' %  ! !""#%%&&%)('+*)-*)-+*.+*.+*.+*.+*.,+/,+/,+/)+/)+/,+/+*.+*.+*.++,,,-,,,,,,--------.../../--.-,0-,0-,0,+/--.../--.--.,+/-,0-,0.-1-,0-,0-,0.-1.-1.-1.-1-,0-,0-,0,+/-,0,+/,+/,+/,+/,,---.*-.*-.*,0+-10/3437.34',-%*-*/287;<;??=C@>DB?HEBKIFOJGPDAKWT^|Pbttě~2>M@L[`lgsnxq{szszszqxnxnxlvjtcp|`my_kz_kz`k|`k|`l{`l{`l{am|_m|_m|_m|_m|`l{O[jDQ]1>J17D.4A34B45C35A57C67E45C45C56D6:F7;G7;G7;G7;G7;G58F69G7:H7:H99J::K::K99J9:H:;I9;G9;G6:F7;G4;D4;D47E36D)*89:HOXcnwivbo{bm~cndoepfqfqhtkwjxm{ykyLZiGUdP\kO[jNYjMXiMXiMXiMXiMXiKYiKYiLZiM[jLZiLZiN\kN\kP_kQ`lQbpSdrVhsZlw^l{[ixam|r~z|{ؿطηιййиϸϹйѸизϷϷϷϷϹϹϹϸιϸηͷͷͷ͸Ͷ˴˴˴˴˳˳˳˳˳˳˳˳˳˲ʰɱʰɰɱɱɳɳɱȰǮǭƭƭƮƮƭĮŮŭĬìêĪħã|{vurq~q~vq~Yfr-9H%1@.6C08E9;@9;@;=B;=B7=D8>E3@D0=A'GJ;[^2ky8q"k$mmmmmllmnot}('" q` f ii f `[ VO| @y9r1q /o.n,l)k)k*m*m)k*l+j*i(h(h"&i#'j"&i"&i#%f#%f#%f#%f!%h"&i"&g#'h"&g#'h#'h#'h"&i"&i"&i#'j"%j#&k"%j"%j%%k%%k&&n&&n*'q gV#*jNrpZQ5676F@~SqTrf}v%%%&&&'+*(,+%.,$-+$)*"'(%%%$$$%%&%%&'&**)-(-.+01(00#++#$ ""##"&%$(#%)$&*#'&#'&#'&$('!'&"('!&'"'($'(%()'&*'&*&%)&%)&%)&%)''((()''(''(''''''((((((((((((((((((''(''('''((((()''(''(''(&&'''(''((()''((()((((((''''''&&'&&'''((()(()''(''(''(('++*.-01256-01'*+!$%!" ! " #"!%$#'%#)'%+)(,*)-,+/,+/,+/+*.+*.+*.,*0,*0,+/,+/,+/+*.,+/,+/,,-++,++,,,-,+/,+/,+/,+/-,0-,0,+/-,0--.--.../--.-,0-,0-,0-,0,+/.-1../../--.../.-1.-1-+1-+1)+0)+0)+/)+/)+/)+/)+/)+/)+/)+/*,0*,0*,1*,10.486<167',-$'+0346;9;@?=C@>DA>GEBKJGPIFOB?IWT^}|Yiyz|*7CER^kulvpzr|szszszqxpxpxhuer~_kz]ix]k{]k{^l|^l|^l{^l{^l{_m|_m|_m|_m|`n}[gvMYhAM\".=(9!2 1,)!2#40!0%4+7%1$3&5%5%5#3$4&9':&>&> #9 6!&6#(8!+:",;)8#/>"/;!.:#-<",; %%/>JWcgtfrbn}`n}ao~bpcqcqcqgrjulwnyzlwHVfHVfJZjIYiKYhKYhKYhKYhMYhMYhMXiMXiKYiKYiKYiLZjM[jM[jN_mO`nObpQdrTfvUgwXjzYk{bn}p||{}׾ٷηηззѶжжжеϸзϷϷϷηθ͹θ͹θι϶ε͵͵ʹ̵͵˵˳˳˳˳˳ͳ͵͵͵˴ʲʱɲɲɱȱȱȱȳɳɱɰȰȰȯǯǬŬŬŬūīīīīūūť~zxsrrrq~anz?M]&4D%/>/9H7;@8E7?F2BE/?B'FK9X]4m}8q"k$mmnmmlllmnw%($  zj m mn h b\ TK} >z7s0q/p/m.l.l.l-k.l.l.l.k-j)i'g!$i!$i!$i!$i#$h#$h#%f#%f"&g"&g 'g!(h#'h!%f"&i"&i!$i!$i#k#k!%m $l!&k %j#&k$'l%$n%$n'&p&%o^ R:fYtgeFA9:F={LnRtdzwŴĵ"%&%()$-+%.,%.,#,*#,*!*(!'& &%#'&$('$'('*+%.,)20(1/#,*%$ "!$#'%$(#%)$&*%)($('"('"('!'&!'&!&'!&'#()$)*%)(&*)%)(%)($('$('%)(%)($('%)(%*&&+'&+'&+'&*)%)(((((((''(''((()(()('+'&*'&*'&*''(''(%)(%)(&*)%)(%)(%)(''''''&&'&&'(()''($'($'(%()%()%)((,+-01/23112))*$#' # !   !!"""#""#%$('&*)'-*(.+*.,+/,,-,,-,,-,,-,,-,,-+*.,+/+*.,+/)+/)+/',/',/',/',/+)/+)/,+/,+//,..+-.,,.,,.+-/,........./--.,+/,+/,+/,+/-,0-,0-,0-,0-,0-,0*,0*,0+-1+-1*-.*-.*-.*-.*-.*-.)./)./(-0(-0(-0).110498<367),-!#'-/357;9;?<>C=?DB@FECIJGPJGPKGT\Xe{zgss{*8GM[jo{nzr|r|t|s{s{qypxowjtfp_kz^jyXjzYk{Yk{Yk{\l|\l|^l|^l|^l|^l|^l|]k{YetMYh;HT,84BJ>LT=KS6DL8FNAOW?PVBSY=QV>RWEV\?PVLT?OY;KU9KV?Q\:IU8GS6DS3AP%6D2CQK\j`q`n}_m|_m|_m|`n~aoaobpdpfrhvlz{lxM[jP^mJ[iIZhIZhIZhIZhJ[iLZiKYhKYhKYhKYiKYiKYhLZiM\hN]iO^jQ`lPaoRcqRdtTfvWiyZl|`l{o{{yvٿڹιηззж϶зѶе϶еϵϴζζζζη͸η͸ηͷͷͷͶ˶˵ʵʵʵʵʵʵ˵˵˵˴ʴʴʴʳȳȴɳȳȳȱɱɮȮȮȭǭƬŭƬŬūĭĭĭĭīīĩã}|xwut~s}r|t~jtMXi1E2BE3CF-KS9W_4k8o"k#lnmmmmmllny! s nrwke _ VJz >z8t/p.o0l/k/i/i/i/i/k/k.k-j)k(j %j$i!%h!%h#&e#&e#&e#&e!&e"'f"&g!%f"&g"&g &i &i &i &i&j'k'k'k&m 'n"&n"&n"&o"&o#&r$'s!$pb [1=L~aMC?>G=zOoSsg~y±į쫱/ conn= count= op=ver=l4S 4S*L 4S %4Sc c4Sʄ 4Si4 4SS  4Sr 3 4Sע O/ conn= count=op=ver= 4Syk/ conn= count=op=ver= 4SL/ conn= count=op=ver= 4Sf}/ conn= count=op=ver= 4Sב'(/ conn= count=op=ver= 4Sң1// conn= count=op=ver= 4S/:/ conn= count=op=ver= 4S:6B/ conn= count=op=ver= 4S˘ J/ conn= count=op=ver= 4SR/ conn= count=op=ver= 4S*W/ conn= count=op=ver= 4S"@)compression=noneop= size=||& conn= op= time=4Sbk4SF}image:theora+Xiph.Org libtheora 1.1 20090822 (Thusnelda)& conn= op= time=4S_ 4SF}image theora(kIJs1R!1b!@mSgVx9[l*hT()$Zy9fS xU)$|<AV* b!|< @86y,a/ǃbVB2E瓙e0%R8H!j4 b@F"`,@!AAP!QQ@!AQQP1AQQQAQQQQQ!1AQQQQQAQQQQQQQQQQQQQQQA!QA1a1Aѱ31pSa5u!bSFtт3tvwT'Fv11111111111111111111111111111111111111111111111111111111111111111!!Q!AaQa!aBBBA!A"BBBAaBBBBA"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBA!6661!Q&666166662&66666666666666666666666666666666666661QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ!!!Qq!!Qq!QqQqqсᑱAqAq!Aq"QAq"RQq"RRQ"RRR"RRR"RRRAAAA|^\t}^?/f'|{rE7~DR4̮؄ La Rw;i]/GPld~rbWGy' UHAUHƂ3҃]XVy̱R"P Y4GxþG+1g oPY]Jw #͵I2ߎLbU'"Lcbusi.webHVr.egEva4mʣ(TF匷} Mi;:Zt|*Rz1jɦtavV=hK 5='$Mu)UsCa4{Z̷?;G3+\h&i=Z _|G|YeJXu| UsYixmG'=pU mvF~a nc SP cIk,:=E d63L塎?#=Э4\XM?hSP9to8R:>! ڤM.een)PM+mt<cAedzRbH6+Iʈ[u~a+W`APޥ0k෧ވK ͵Jl)FJP$^!g/9N߫xcU8$/Jm3QsVFǕ)#H2imqKGBbimh@R:iIMa4 p{YY`DHJmc*˿0M+mt4T_~ 1AmyUHFHJi3ms,p!v/{W 1j f˖#´/z8q1mF /Gʚ>#q<9U$OQ mY4/끦m07$hOeDO-a\8UIedBsᶪ^3c^Jւ6+I}{_~^}ݼ} Ͽ>{xyx>x{;վW߯}Mnoߝvor7}}y>h{/~}yy{}>xݾx}>x>x>}x>}>x}>x}}x}>x}G>{}{}O{}_{};}Əigr_7=8OM4tAP֕E2*-[W (F"?Lsc;)U-=sj# =?0S-Z^4gUKU*f &*VBPUVTjsb:BڥpֳCn}bmm>NQhhѮ@?u:N8ÏᐧyӉ ūu8IcH3 wT*QNNHĥZ'\ܹ\ }ZK=N<1M0qL8kL[8BO֤-jT<,1Dr|_[s@$JPn&f4i\y G.aÍrSɧ \baF=a$]b]"ux?s?Xz*˟'qǸDÇ8c)P׽MVK0&sJ2F M1'[!^t$e791&Fyf C1YkaPXK_OT3bj[vUc>1\8ͬ8ÎO2w2բE=;%˗.\s˗=pӸq5Êc)zciwpL<}t9ÜS)a?P@0xb:1w^-%$iNjs@OßLG=4N&#fg"NCqL; q:;s:G.cs8ssÞ5î!p98qLp)ORjS-LϧSÇp* # zu;sɇ-<]v#xs5麴ӿrMr8B8i.O>?G{Þß=sC߿{{pwppÁ6FR6"Y׺hAP $U٠ÇTB骄`b$m獖]W"g JK1t72nYTp YffqjM*p2+9źc{!*$aQ.c9Tqr9#&9xF TaÇ5Q8rX H`?5tP$+R56Ybh2gh')£efBrR::DT~ #wC|ib@T\Kw`f5L,d|L4t38}t]ރw~G\E"W·~>]߿T_* /2|>q˝E GBh3 d'Zӡ:C8-px(M`$)# Zx`:Lߋ Tи,3\._mW|zޮ{iRt9KJ&%h[W *Oǯ[}~?==Q&ܩ૔>>ﮰys{nmqg"zsDzOZAb%}$׮rZY!Fc}֑\)`B.pZ/OK[ν|}l:E2)+N:V˾솵%&&rZ$HX#{y'/p13hi/3'06fNffLffq"K,t̙L37gspUXBM3ؿmµݑ!X/d"gE3pC(j3vəcL̙:1$#B_2gffd4hcO_e&pfsb"J=.W6̈tP"; #3;?Nng"LDD!38̾fqD>k0ZgA5[c5pwRLf{3Viӷb^3A"D w7" @B!NP"&a Cf D@@@$D>"";"g9x"- @L@32$@1 @1$@ƤfL@#D @ r"c|زK]j@ DLB@_cܸt?qDD ##hF0 CbeN0 D@u̜+^fn(R\E癑Be]qO;[BfLw̭ٙ2f*R;xLQ3rg332g3'33&s{_(T(V 1~NL׆qfemo2fdߛhLfffqbg(9:|tѧG5jթڵ+my^}/強bם`Cy;6nUbc4xkׯ^x!+/wFRTj߶3o›U` (BHk4?B}YҒXـ%F6(PB qҺ2r9\PB +S2'&(PB 8L0FbT۷8&%)FU;4]7XPIE<)C^dhH9%t㮰AÞdv C/]2M,_|l}'H]vKn;׉[6Î5:qc$XR$PtQ7~v93+1VqѦ`ƌEH/$D h``Ks&У|f1 &1 nB^Gݽ1:{2P.(q)c=&"͈:bD?`@bc Q[vniC5U T*V3X -kZEjv9 o6,jz<ժ!J|~7Jv0 9 6*ctijxx?EUѦAծCCrZ=< m>^ WZի"' Y)dݷ~6Zߕ 5-~Zwl Ll[W-kYAYThѣux{(4*Z}}6,5͞^To=% lѸ ºuzzyקKMgvC~>>% ߸m۷m۱vnBݦfcFh!DHDzӏk8b.EH\؈O+c'_.?A s$, ą,ioϺN70I0M9IQJDc~yDZBi$JRț$5S\dd)D=)/RO~Dɭǽ)eYe():rN"DR$JYwR?OR xwa,!(,.c C!CǰQ#ɧBB`x"J~o/Ϟo;B"B"CtpNZ^J$H|Z4hr|Z7srWK(%X 8߿~&,cZ߿~KůEk*~߿~Е dF4[yL݋I=4̀m3i4OrѥnQ{$i>F{|ϝ_ZP斌ͤefو롅b^=-S0# СcGPZA7h3gjdo0Λ=m=nhhz3kKNd/}1φ XwqxO sU211N(T p i u@KH 1')K1TxmLL{fOOOMo;5991i!&4ns;͞R)'tL2/8}p&<B\nkG4E)iFI]]Di@wwwwwwwwFn jg&y1wyŁffk3Yf5fi<{1hѣuC3tnQflhf5Mc#w)nkys5tr&JfNNN 9998Ljrq2r3ԶRms[ѡ!҄!F0H<љfk3@#Hv1w@t@=!q@1pe}8Frc1qgQ33b,fc3;bf32;fc3333323f01c;3 ,(Σ830Hf31f31̌6f31fc3# 3 fgfc3w13c;;Lfc3#83؀cfG`Tvt w%g/3.;%xəlˎ9ƙ̺ce.1X_9I@87ɺ+ #R8,eaug,(yW {K$g\ bĉ*[ ",PȌlEe_Dw+IyN50mlY6N7=V?) ĚSZ#Js p‡l]"NXG8ݑDMc}Y\YdN\ٕfW^eyXXj @u]UPꫯ+뮺+ UUWUWuU]uוX5XuUwew(hgA9|?K^p>WHM)thȱ{yfEc,@& conn=op= time=4SJ4S/cameraCompressed Depth Image Transport - Compression requires single-channel 32bit-floating point or 16bit raw depth images (input format is: bgr8).w/tmp/buildd/ros-hydro-compressed-depth-image-transport-1.8.21-0precise-20140617-1547/src/compressed_depth_publisher.cpp!CompressedDepthPublisher::publish /rosout/camera/image/compressedDepth4/camera/image/compressedDepth/parameter_descriptions//camera/image/compressedDepth/parameter_updates/camera/image/compressed//camera/image/compressed/parameter_descriptions*/camera/image/compressed/parameter_updates /camera/image/camera/image/theora+/camera/image/theora/parameter_descriptions&/camera/image/theora/parameter_updates& conn=op= time=4Si4S/cameraCompressed Depth Image Transport - Compression requires single-channel 32bit-floating point or 16bit raw depth images (input format is: bgr8).w/tmp/buildd/ros-hydro-compressed-depth-image-transport-1.8.21-0precise-20140617-1547/src/compressed_depth_publisher.cpp!CompressedDepthPublisher::publish /rosout/camera/image/compressedDepth4/camera/image/compressedDepth/parameter_descriptions//camera/image/compressedDepth/parameter_updates/camera/image/compressed//camera/image/compressed/parameter_descriptions*/camera/image/compressed/parameter_updates /camera/image/camera/image/theora+/camera/image/theora/parameter_descriptions&/camera/image/theora/parameter_updates& conn= op= time=4SzT4STimagebgr8; jpeg compressed bgr8TJFIFC   %# , #&')*)-0-(0%()(C   (((((((((((((((((((((((((((((((((((((((((((((((((((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?nfAPH8FVsKTrSQyjmǽYE؍[BzUȪIҤN CIN p4Nb(iE%)-0RP) u/ҒZJQHhO)@ )E4S (ER m8P `K@QEQKE 4mBM%8R%;%9)ؤZu iT)"J)Hi"ԋQJ< T0T()hi(9>f}ZOҳoI{W[lJQ~xs&7J8:y*̕VCQTJNi󟚢Eޭ+5ZDӄք5t89D>JPF)hm)aEPP(–R4 (ZQH)E8QI@fJ;2)`N)-QEӖ)š))E K@-8>RKE0Iqi)i(Ji =i 8h PӚu1)q4S% zS{ڙސ-JԫL Jԫ@ Z@)iAA!J;̾R4r}61nk?kzIzLLds*Nnd6s`*<ԔL HUSLfhsWA6*%ю*LRF8LChK E%8S(P1@P(PE\RZ(4RQHuucN(4( @QM: pӖ$Zpx (RE (!) :cHiԆ yUSTӅ RZC@ E4jyQCR L}ސ-L @LҀR-- 4N4#}qZoe4r}+6z{WW/ߗTj+X[8 %YZmJRI;sM \4o)}R 9su _2]pI+Dxx¡B&Fv0)MHE1 P"7b1@ C@)iTRKKF)1!)qJ%QJ((QE:Si NiS֙OH):T@F)E-JhZ((HRS!(KI@%SyzSI6M)4;ҚA֐'JyVJJjeWLt:Rb@1̿ f_R4rR}+zW'/讷x,@6sK)GOzN.7=UrTF}}25r"s>U& k*F^2YCG"JTUHzpsMח҆;l|tEw~M`ciŸW>sAs*LqM"ԤSJ &)2S.(MK?b1@Ӏ xR⟊x&() P!v)1@ KKAS)S0T@OQE}-RLZ()i)h(M4Ȧ@ 4L"RPhhMR3HM 4ƤQIJ=T)ҦJjeVJb%QJhZ\RR){i5 i?JͿ569) Z5͛+?]) 4N1*8H<6H$R2VD\4dE Rɨi+V#F EC O>4B˒=ETsDqB΍CbUTΡ+`X?:<"Kʎ; .=zToң)ȍ!&:(q1dX'ޔu 1RmI~~T n*fߕ4տ*`8oʞߕG1O*êʓi? pCOڐ  bJ3SEB)&(:S!֤Nu=E4 zH*E \PQKJ))hQ(44M4M4JZCH\fij3@.iIgBh4H=j㱃'?K75/ J)tiԵ0?O &5MS?[–b :zoMHF?f;˸Y կI+UX,՟[N>Ӆ޾:jskF,g}#(̧GO,t?h?4nsWgYK,tۚO>mG+??S~G|9Lu'[~.)?B 掟1fR /zj Si>iWk:uM6o 4yiomrٶݭ'eC| 9Z.mKSmWi 6ƹ#[vEِghJi?Ib#E?Z?>|?R?ЮG==4}~_CSp:WUr;~uƛk?ofOv3O 4\,whf$OW>Wr͸ꀞ8h <3#^LaX Vɣq Ww]և945 5a5=Pտ*FFξׯ@V k=̇fzL*2oP?3~#n&Q?+uxsup#-硐o(*[R sK䟮W@ь)i:ք)i)hGZ ;P(4 ZZnihœ)ӆh–R2 :AN)h) P((N)EQZLRяZZAN)@)i@=)@bb \Q@)أҁ@K4 Cy4 Ԫ(- 1NbbR&(- n(;P! v(7bF(v(qIhhNa?})PE:`7mR`:Qjp`zQz QErii:Q@h4 )hPp)8q@ (ށ 8 h cJ:P)iQE-R04 ZNR)€9bB)qKK@ @SK@SK@)b@)ؠm{bQPRSF(Q(SHhRP!SE E1LJ)hBRK@ĢR PqN.(7JQF)`NӅ J)M%!)RciҀR Z:)@QH /Ҁ4S )i-(RRKIK@ EqKH)hii)€KށN.)E4q0(b@)qF)h1KKF("P1))أb P(t4Pq-%C@!CE @)4PRE4QK@Hg"(}GF:Sw/ܹcJLFFzuQJ94 vP0H)hER/z)ÚiԂ(h(SQK@A֝ER )E(R)P8- RK@)iqKmh @ -Kiiv )qKCE.(@ E.(@ 1@ъ~)1@XmQh4*ݎ(sI;Z(@)ؠRw␊id([0IPC.)xiR9 3 })*x@p{ŠN=hޙКc9O]koek_DI?/.r28a5&\fJ.˽}~?Ơ ϭ!]z1PRӸz}vmT~\ ڻ>ґ(l}?KQp&cAM73~#ebPسƅ' OARii@1E6r>cJg/~5 ).=ezR$p;ܩ9U>hu%N4 i+ag禦?i Ύ?QOih裓}ཏ(Χ9Ei[~])5:TKJ( crHG?Ƣ"Z61x=R3Zg0٪~Ty4lsm8`+SJ</GORv B AdZoF v:6|Cah }dO:~M6tռ8+t}}aS)zQ'(I}Cmq*^띺_TtX::???žsJm^CZ#DЯSCӆݶp^@ Q'C5l<ZȴY+Aҡ?s Z!f~ou8k'Ui`' fǟo*EϷK7Np?$ gng5[W!u)5:C p}o:,}U S~ԇ_& ??ҔM(|M2)h+}1z16g.¬a|M1,ge_o컏NU\8l?ߐEZ:ߋ;x?YiZa??i|m #33-OVq?.?5Dڏj12T=Ԁ k^)Y:xi<UFO{xw1T&xhǍBuzESR=iO?л)0ܓ W֤[sx UD\nA:cf|rgGG4,h)r꿝VY.>`'M3oj/JO<5#? 鶜ꭃ?ݹJcj idz&LLh1E$w"͓v':? `=Fh;\R) ,4!ZSQޔP0- iQE(9PP:R`)h9OQKE ZJQLaRъ))E@ :"y0)P1@ P(Jp({S=)QqK(h8m4KP)q@ )BZv)vqF8ͣւoͣ֔(mۊaQڍm&z~@(}1OF3mii 11NFn(;hQamϥ?`MR@ iGZv)n .ޝ\qH`ҁ;`3@QH)EvP")()’P1h)֜:qJ(ZZ((P1œ)Q@ %-.(R9jAL"Kc@4 x8P=G4ONOZ4 p)q@ 8 P(S@Zfԛh@ PRbۊ6PDQRmoG\SIf(?oȤILP6E?O"Rb&(ʹb4f(?b)1O&8LS77m(?P;@.)qK(/jJPi( 1(QQJhZZ6E(RӅ'4: Q֘QE (E< `--%(bR)E Q@RRp0T@ )Zu((OQMZx1ž)N8S %(PpR@P)ER@ HE:b(()!PM%8HE&(#4PqF)h)i %S[!NѓJhQ,H@)!4c`1J(P(8z\TLVLYh$eSRf&8~M?q@QɥoʀKAۂ3)bbK"(ʎWP0QgPA0wΗ+w }i v)7/Nx~tb)?x~t@ܘӃ'b?@+?:o SQKz(S*EǨAp) =hSGϥ!< BDZH1(ӂf\SN JqLTMN)SK~KxI#!SI1E<&(4Qv c=\R@E?JyDtbъG1O#ڛ&PM))S v(1%zqcm`z~UV(!ϧo[ɅIw{TF48Eg#6N?RisJ?*nGt{| םY 'ш?G fžthyQ)sdxt7<5 ?F_v~)קd[>(>ki8ϒ‘|SL @zNq*ca:}s²5 oe10Tx,G+?8J?qhCGJ5dܘSvXr܁&2;¢m ِxQ<G?jq<,֮s_SN6Nm?AGTwP w'm|qn~F$1Lmr3lGQ<ʻχy=>[k^fT#X&=IjG6?j*zpog-;IUkfy:uKcεQa窈~ȸӳ;R-;uOkɆ`?i~W*퍅|W~T{H*zs8'Qrp?z4ex 5(?qW:u|;vw Ƨ5s[*`w'FQNҍRDQ>˝_v y|}D4~?_5cNui` o Ʃ7_Wž'kbx,8*DlKXG[!u('8 4Fn^pe1EZ~x=x;@P?:|oQ0:(cB)󠷙k}1 | =-yNݯ:~H?9|NҺ n_?٭S/N]:L_[hP|g^gͥMy26c1{STӧPG޽\2O!z9>./3]*?A2O.cWҰ#[MO1a޻cJ\I2˫'|hytObhjgpƬu;.Ϲџ[~' D[B龝Э. =6čJqST'4 H/Eܴ$|l Bc񨿴1jڰ|3@͜Xaפ/S?/?툤::ѠZCρW_N6v쩇VGaa4ë(^._cZs3[xjVAToxu+?@ς5S'iZ"?Q}s85-?8dzuk}3fWAiw/j/-Hƛv6k9O⡌^iO?C?Sm:LzW?=5OIZ!r/4r gD~in(xZ90S#ͮ8|n6<1hO ?~!n?NȞfu¾"G8ÚE-mm¹ѯ?Ml Svܝ@utrs6}E3H=x o8յ-.;6-Czʾ|W~:^&CMc8\|Pt`t?!]SPO=E5K]O(<ҕq݌q6~ڰ K ]Į3N?J释n(8??‹.puCۥn]Ү#F2m?Z^ 'g$TΌ \ŋ_#uiZnq%37Zص1SEui0U$gJ#nC qIWͽ>Lkko tS5#KkCYTYjUu;^n틑 \.MsbqDO⁙ZiQZ'NSN8?)EZ6SvPHlhTzReͿ*h!4[Fgr~7jEѸC*4I3 [do*&SEZDTeVTdhaяRn sQ1HTQF K

;R!4@Q}!5 #֝0Nj@x1D+czҋ %v=;W ju$Ӭ-> 6 ˃ @¨+P)Zn+sNkoY8S)!t̙# 4wށ-Q=iZd9-HjKZϽZwLF=k}j7y/ ռ#+`;φ\>.r>}µ#nђfUǯRb:B|Cu(薻O԰ Eܭr֭ -o9UZ:%>"LM?&Ϸif"E{#ϾXCwus2B\gxI/HoZ>7|Ѐp+?}kF*sgúo 1>Ze{ q{lY3 ~UzKЦ;?\>Ln.ózsBFA tϦA;]$L5|0槨gS#zo4UNᇇΓv^]8<'$ˇaaaWTP2ҵ"QZ~`.:5Hiӵw=цnPWpzs@ksSG>x5S3f rj5o/NkF'ȤnՉ[媖(njTx5vP3K(3b=;Uφ F(`s&Y"OöaU2Ԛ#l!zgDxQdYz6MV\R=c#n+~`*aX5⛃zpZMi 9-IeFוJ!7,LњHz7EfFj ȩLB3N"4 P1 zPIMESCP545<5B) UpiӸJ_֩uZV* jE5YC@RP@J2WL)2USL QQ%Lhq (2)1RSHKE45<n#MH\UI\z( 3nGk՗ kuHʠ}kwF$LƼXlXnŽY4KiBq&tJ)q;dHPgk պ# ([0i@ i[[#) R]--Qb#Ucf:Wr.e*<Ɖ#S(6uA}\rN)$F}밮KxZgk!-ϕ8:zcK֧!:y (WEٹblN9*zͳr֌\\*ځf=hCg[Z]6FU<-ʠטx!"%b;LVɺ<c8̧{T_-(=sD\P^͈ $]ud &(u2*8s;&7VMk# uw=i[JА7,7Veˌ5-ֳvhh 6K4-W[Hמw>$yQ~G"s 3<)pqH-]5%vTv7X+>]UlXl۷+ji`D^SSL Ri)FiisLhK4 $ NN;(48CS jt5E٠E[dVrUCUqZErE[{ԥsUkr ӔH *4ɚt~ _6uzr o{jgĀ{f4OC7Yx4ɌHjLtZA?+T6&[ +WEd'VH5sI?BGYm!Sִ±an~&VL;LEkYz7=C6$5I:B+13HC^Dk4Jj`Y,IiA->᡺BNgvҸxW7ȴ\Yk.9?3a~~9r͖tV-0%5}ꀉWS=Vis75# .iњ@:\Ki4n/&( R+U`=iJjhUV5b|Sp*BW"j`\Nj*\ iS%CJ)% CM4֚4M4 iڞH?-WcSҫJS皷/ݪLiCUd5ZCH 7uPUVcCSPOVWN @R`z*IjG'J b#h `C1qUp6V9SoSuSֺ6zb\DŽ+_mqVf'Z:f{e +爐YaF#4&IFlJ:/f*;qX;42W~Uťt5f+onqk.VZ:ۭך-[?Զk5XmxeC~@r(WgW|OTDlsڲmj{28N}MS޻@Qt`FGKLv(p8yLbǭuZ-'6yFkU2 %(өL4Q@E/Jb^YRj?ݪo@25UXi 3UsOoޠd۩}n"}o(TɃTHޘ?5q5 ZE/Ff'(b3ElmVoz}f3\ֺoH| Hsk3> H|d RFoFr[}+dfRƤX:SS \A1sA\v`HGZn:ѳ`d^)ȸvHM^R*j4$2ճqɫ"'Z6 C3m.JrNN) Z)W0:Q5x8,WjU9{SI$rz53W17#L3[L4ƫOiE3|rSIkuݰ=BQ&Ɯ2v2jP1JOAwr*U\Tfd9*1 `fI#4,TŜz/Đ}z\/R 2l҃L)Jx=*/) 7@CЃ"Ccè;VXR"V_VtHa*ULc)i)iƑ aڤ5V02 SUۥWMݪrP"VJ'J!2/I^ٮR.xY9]T jnYY tК֐+F8Q`/2X9 au(R {IU?tc ǡқMBqFSճ5rnn?頩8e t|U 9e*sSI҉[:2A+֚`i\ɮFroM|5\ίtvӾ@G"coҺ%(BGR}ǤKm̨*ڌ.|WdPx<;R0 qc9{QpdBO2)@$@^5q2 ohߥMv- ǵ7a>ԠOA@@ FsAQv' =+J{}j-P5e![%tFzƥ_Dfm&5K|\`U#O5dD*]ʃ2 H#K7A[RCq,@=\lc6$QnNl)i$,}YTs8Sj愀cS R+P#F9?x̱ʻdPjo[Gȣpc-77g_Lm5.hW;yWU MDI$P@+ػI"ThU"PInD~b"ҜPkH}*tta:U 4Q@ M4M4 jL5!Ƥ" US@VJCW.zU)(ZSTlUMg\f,A3xߝy5Z~U9W} {ړƝ}'?[o sOFZ9+s{At_IKgCg')[U#WD|0b_, LvJ>A}3sDE#Vԣ?;3݁x}zb_|=v qB}k_ mБf3ҷ.iKDsMh5'GUkXUh"<]G]ռFrTWwGF^¹ƅe|{W {ĚH,އiK]QĹZNV7Wn[#(}| joԐw;㉍[QT9յ\sCp)ZSI c9ю3`*JSEt}MSjzIƚC$58ݏjڬȣKA$MarqӊL0(F(ЀCDq'SFzP4u3zZ~o*}+GuCv5Zމ%%qUCUM̼,ǠJ|b{8r kNk3SVR3G?]J"1X;ݗ^H@c9R*7ZV/ җaəH)0E}Ѻ'B#b ?5n'䫰ɑTldlԩ;PMWVPg%I{7ِ֛/C=IS"´gdv>՜r%5ٗ޳`s.G?=ݫt`{Ӌ: -OJ+Q Jq!8M#4RaDmQFԀQmEVqH w%h2+>qM7z͹59ُ&)/]Fico%w Kx@(OOHaRC@|!{힭?m=&}:Y'c$2ʝ"[;T'pGyrdUQR.S_`q% NYjt N#F*t7zaNV(]ӵ92n~]ҭǥfFL4G[?WKptygX-gҍլZ")o=vױh")}텐*䏮 fiYүf)=G}0ufs(MŞ4\Jcm#*5D>6 Koޣ-fW(0VZ^. X^zж{qR J u%(M ZNHD~j'5r?TBcԒ߽YǵV ڛ`''~)Fy!pNiGJKIJ($KQƟQIA/=ִEf4’ĢD呂"]EʺtL|kG]۟Ҳt^ww;}3Ir=BtӬ̘˟Ry?γ~\(((#Q8RcZB+Rtɠ W&bkbI(^\_s: 18y.^? Z72>5b== ErhwWpZƣ/ﰮW"? yVjFQMW+TqivM,tڜL{c{nso 8K{ W9ct([\/mb`IX Wa1֊rԧpv=?Ht|f_MSNvuC>8R[ꏵIo[R> YLcU8dzAIKI@8u^TXZ2U9ncVV) ⒖ Z^i);iq1@Z$'V>ov1sL?dFU䰖hm"%^wSZz}*ـW֜l1 OȄ+9DZ(Ԟ5b_ڀ8cAOZfeBXמ1B}>2vW+_%vT ĻbG[5AQ:ɎqQ 9dFSSKV\S&E=ڛkpFƟt OQZ1s\;G0$kr "+B;֑LׁpVT2&]Ӈ$Ʒ[w8=g[Iδҋ_rmԉ~%u6Բt?5nٵh&Bva`PGYmSijm!4@ƚaaii@d5]I1 taaTnbTd5VBrk.\j\ʻ8SP#ɥ\w$s{Cէs}:gR[y fNk?h諛F>íUj/=NC\̛5jszEus9 X(2K;]woDE0 8tlkYwUTw P(Fr*JbU\pGzux3רZ^ݏpڰ#/QYH{"f|[3l-}/-[Nl޾ Ty'8>aF2V\ubsRE5F wRsI/zJZ`Kl@sT?ַ֭Qq:U* qV LLRiEP+R:ڭQsX~iZDĦ[VVqYBqn=:,Z48ү$?ò5c'{'ri ԧ1iUaE'J #]*%MozelsM"ķ,Gjk` [k9jУ7.j/-I8M=c1))q\gp1T$uN!sp)Dw3~q&ql!'*o3K϶|ʠlĿ(kҮLڽ{$m*@U#oO\XC 9+ȝJbIXL.>=lii41SHkhiƚE;Ʀ2(e1HjJ(]J*ު2u"Ⱶfcpވknz2Ĥnd8GwD8m j1z em &C[vE{T+WAҵ|'lilLis^:lsZjlZc%Fp+˄plfяu)a#bMXc$Iz,55ߩk5r7pNJ7_"j[xwœy5֚9$+ax-{ihe]NExH'ψ.|;u Ku$=Wןa]]hpc_Z˲;Zyk͜H$|Ep%Jŋw(F;U-iؿ58i3(gk2p1Zn1& conn= op= time=4S].4STimagebgr8p}|o|{n{zn{zn{ymzxlywlywkxvkxvnywlwulwulwukvtjusitrhsqitritrjsqhqofppfppgqqgqqgqqissirujsvkuulvvlvvmwwmwwnxxpxxqyyrzzt||v|{w}|w}|w}|x~}y~xxyz|~{tgtxl}~psvy{|r||q{{o|zo|zn{ymzxlywkxvkxvkxvmxvmxvlwulwujusjuskvtitrhsqgrpgqqfppfppfppforgpsgqqissjttkuujsvluxlvvmwwmwwmwwoyyoyys|zt}{t}{t}{u~|u~|u}}v~~uwxxyz~~yrfvyj}~nqux|r{~r{~q|zp{yp{yozxnywmxvlwulwulwumxvlwukvtivthushutgtsfsrerqdqpdqpfppeoofppfppgqqhrrfsrhuthtvjvxjvxjvxluxmvynxxnxxr{yr{ys|zt}{t||t||u|v}u~vwxy{|}~xrix~j|oqux{r||q{{q{{q{{p{yozxmxvmxvmwwlvvmwwlvvjvxiuwhtvgsuhutgtsfsqerpdqodqocpnbomdomfqofqogrphrrissjttjttlvvlvvlwulwuoxvoxvqzxr{yu{zu{zv{|v{|u}}v~~w~w~xy|~~xpdu|h|nswyywr||q{{r}{q|zq|zozxozxmxvmxvlwulwumxvlvvjttiruiruiruhqtfsqfsqbroaqn`pm`pmbomcpndqodqoeqsgsugtsivulwulwulwulwulvvmwwoyypzzpzzq{{r{~r{~s}}t~~t}u~wwxy}~}~~|rgv|g|~mruw{s}}r||r}{q|zq|zp{yoyynxxmwwmwwmwwmwwlvvkuujsvjsvjrriqqfppfppdqpcpoboncpobomcpneoofppforgpshrrjttlwulwulwulwulwumxvnxxnxxrzzrzzs{{u}}u}}u}}v}w~xxz||~{rft|dy{msux{u~s~|r}{r}{q|zp{yoyyoyynxxmwwmxvmxvlwulwujttjttissgqqfqofqodqpcpobombombombomeooeooforforgpsjsvjuslwulwulwulwumxvnywozxpzzpzzr||s}}u~|u~|v~~v~~xyz{~{pbsyev|nswxxr}q~|r}{r}{q|zp{yp{ynywnywnywnzunzujwuivtivthusgtrfsqerpdqocpobonbombombomcpnapoapobprcqsdquervhtviuwjwujwujwukxvlywlywn{zn{zr||r||s~|s~|t~~t~~uvzz}}{qdwxexyosuy}r}q~|r}{r}{q|zp{yoyyoyynxxnxxmxvmxvjwuivthtvgsufrteqsdqocpncpnbomanlbomdomepncpocpodqpdqperqerqirujsvjvxjvxjwukxvkxvlywozxp{yr}{r}{s~|s~|s~|t}uv{|~zpdy{bwxlsvy}u~s~|r}{r}{r}{q|zpzzoyyoyyoyynywnywlwukvtktwiruhqtforfqofqoepncnlbllbllbknclodmpdmpenqforforforhquhqujswktxlvvlvvlwunywozxp{yr}{r}{r}{r}{s}}t~~uvyz|}yqdvyeuxpsvwz|u~t}s~|r}{r}{q|zpzzpzzoyynxxnxxnxxmwwlvvktwiruhqtforfppeoodnnbllajmajmajnbkoclodmpdmpenqforforgpthqujswluyluxluxlvvlvvnywozxq|zq|zr||r||u}}v~~wxyz{}|~~~ytfvygwzqtw{~vt~~q~}p}|p|~o{}py|ox{ox{ox{nwznwznwzluxktwirugpsfordprcoqamo`ln_km^jl^im`kobknclocmmdnneoofpphppiqqkrunuxluxluxlvvlvvoxvpywr{yt}{t}{t}{u~|u~|x~}y~z|{tfu{hw}quy|vt~~t~~s}}r||q{{py|ox{oyyoyynxxnxxkxwjwviuwfrtfrteqsdqpcpoamo_km^jl^jl^im_jn`ko`kobkoclpdmqenrfosfosgptirvluxluxlvvlvvmwwnxxoyypzzr{~r{~r{~r{~u}}v~~z{}~|rfvyhx{qtvxxvus~r}q~|p}{o|{o|{mzxmzxnywnywkxwjwviuwhtveqsdprdosbmq`ko_jn^im^im^jl^jlajmajmckkdllemmfnnfnnhppipskruirujsvluxluxkxwkxwmzxn{yq{{r||r||r||v}v}z|~}rhx{hx{psvxywvut~~q~}p}|o|{n{zmzymzyoyyoyynxxmwwluxjsvfrtdprbpr_mo[lm[lmZklZkl\jl\jl`jjakkakkbllcmmcmmeoofppfppgqqhqthqtjsvluxiyvjzwjzwk{xnz|o{}r{~r{~t~~uz|}~|ujw}hyzqsvy}wu~s~|t}s~|r}{qz}py|py|ox{ozxozxnywlwulvvjttgsueqscoqamo_km^jl^im^im\hj^jl^kj^kjajmbknclodmpdnnfppforforhquirvjsvluxjwvjwvlyxlyxnz|o{}p|~p|~s|t}xzz{~ysjz}j{|rtwx}~wvu~s~|s}}r||o|{p}|n{zmzymzxmzxlywkxvjwvjwvgsudprcnr`ko_jn^im]hl]hl]ik^jl^kj^kj`ilajmbknclodmpenqforgpsgpshqtjttkuukuulvvmwwoyypy|qz}r||r||s}}s}}y~{{|zsdsyhyzrtvyzwvu~t}s~|r}{r}{r}{q{{oyyoyyoyylyxkxwkxwivugsudprbnp`ln^im^im]hl]hl\jl[ik[ik\jl^jl_kmbknbknclodmpenqforhqtirujsvjsvktwluxluxnwzpy|py|r{~r{~s|t}t}vwxz{~ysbrugxyqtwx|wvu~u~t}r}{r}{q|zq|zp{yozxozxlywkxvjwujwuhuterqcoq`ln^jl^jl]ik]ik]ji]ji]ik^jl^im^imajnbkobkoclpdmqfosforgpshqtjsvitxjuykvzkvzlw{ny}py}r{r{~s|t}vwx{}ztfu{euxqruw|wvu~u~szr~yr}{r}{r{~qz}n{zlyxlyxkxwhwvhwvfutcrqbpr_mo]jn[hl[hl[hl\hj\hj^gj^gj_hk_hk`il`ilajmclocloenqenqforgpshqtjswktxluyluymvznw{ox|qz~r{r{u|w~xz}