#ROSBAG V2.0 Echunk_count=conn_count= index_pos=xop= )compression=noneop= size=& conn=op= topic=/rosout$callerid=/record_1408654217422688796 latching=1'md5sum=acffd30cd6b6de30f120938c17c593fb7message_definition=## ## Severity level constants ## byte DEBUG=1 #debug level byte INFO=2 #general level byte WARN=4 #warning level byte ERROR=8 #error level byte FATAL=16 #fatal/critical level ## ## Fields ## Header header byte level string name # name of the node string msg # message string file # file the message came from string function # function the message came from uint32 line # line the message came from string[] topics # topic names that the node publishes ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id topic=/rosouttype=rosgraph_msgs/Log& conn=op= time=[Sc[S>/record_1408654217422688796Subscribing to /rosoutL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=[Sf[SPc/record_1408654217422688796Subscribing to /rosout_aggL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=[SH[SŸ/record_1408654217422688796>Subscribing to /camera/image/compressedDepth/parameter_updatesL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=[S١  [S;/record_1408654217422688796:Subscribing to /camera/image/theora/parameter_descriptionsL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=[SU& [Sr/record_1408654217422688796#Subscribing to /camera/image/theoraL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=[SL [Su/record_1408654217422688796Subscribing to /camera/imageL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosout& conn=op= time=[Sw [SP/record_1408654217422688796CSubscribing to /camera/image/compressedDepth/parameter_descriptionsL/tmp/buildd/ros-hydro-rosbag-1.10.10-0precise-20140617-0545/src/recorder.cpp7shared_ptr rosbag::Recorder::subscribe/rosoutN conn=op=5topic=/camera/image/compressed/parameter_descriptionscallerid=/camera latching=1'md5sum=757ce9d44ba8ddd801bb30bc456f946fmessage_definition=Group[] groups Config max Config min Config dflt ================================================================================ MSG: dynamic_reconfigure/Group string name string type ParamDescription[] parameters int32 parent int32 id ================================================================================ MSG: dynamic_reconfigure/ParamDescription string name string type uint32 level string description string edit_method ================================================================================ MSG: dynamic_reconfigure/Config BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent *type=dynamic_reconfigure/ConfigDescription& conn=op= time=[S#SDefaultformatstrCompression format{'enum_description': 'Enum to set the compression format', 'enum': [{'srcline': 9, 'description': 'JPEG lossy compression', 'srcfile': '/tmp/buildd/ros-hydro-compressed-image-transport-1.8.21-0precise-20140617-1549/cfg/CompressedPublisher.cfg', 'cconsttype': 'const char * const', 'value': 'jpeg', 'ctype': 'std::string', 'type': 'str', 'name': 'jpeg'}, {'srcline': 10, 'description': 'PNG lossless compression', 'srcfile': '/tmp/buildd/ros-hydro-compressed-image-transport-1.8.21-0precise-20140617-1549/cfg/CompressedPublisher.cfg', 'cconsttype': 'const char * const', 'value': 'png', 'ctype': 'std::string', 'type': 'str', 'name': 'png'}]} jpeg_qualityintJPEG quality percentile png_levelintPNG compression level jpeg_qualityd png_level formatDefault jpeg_quality png_levelformatDefault jpeg_qualityP png_level formatjpegDefaultI conn=op=0topic=/camera/image/compressed/parameter_updatescallerid=/camera latching=1'md5sum=958f16a05573709014982821e6822580hmessage_definition=BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent type=dynamic_reconfigure/Config& conn=op= time=[SZ#_ jpeg_qualityP png_level formatjpegDefaultE conn=op=,topic=/camera/image/theora/parameter_updatescallerid=/camera latching=1'md5sum=958f16a05573709014982821e6822580hmessage_definition=BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent type=dynamic_reconfigure/Config& conn=op= time=[SR#{ optimize_fortarget_bitrate5 qualitykeyframe_frequency@DefaultJ conn=op=1topic=/camera/image/theora/parameter_descriptionscallerid=/camera latching=1'md5sum=757ce9d44ba8ddd801bb30bc456f946fmessage_definition=Group[] groups Config max Config min Config dflt ================================================================================ MSG: dynamic_reconfigure/Group string name string type ParamDescription[] parameters int32 parent int32 id ================================================================================ MSG: dynamic_reconfigure/ParamDescription string name string type uint32 level string description string edit_method ================================================================================ MSG: dynamic_reconfigure/Config BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent *type=dynamic_reconfigure/ConfigDescription& conn=op= time=[S"#Default optimize_forint3Try to achieve either 'target_bitrate' or 'quality'h{'enum_description': 'Enum to control whether optimizing for bitrate or quality', 'enum': [{'srcline': 9, 'description': 'Aim for requested bitrate', 'srcfile': '/tmp/buildd/ros-hydro-theora-image-transport-1.8.21-0precise-20140617-1549/cfg/TheoraPublisher.cfg', 'cconsttype': 'const int', 'value': 0, 'ctype': 'int', 'type': 'int', 'name': 'Bitrate'}, {'srcline': 10, 'description': 'Aim for requested quality', 'srcfile': '/tmp/buildd/ros-hydro-theora-image-transport-1.8.21-0precise-20140617-1549/cfg/TheoraPublisher.cfg', 'cconsttype': 'const int', 'value': 1, 'ctype': 'int', 'type': 'int', 'name': 'Quality'}]}target_bitrateint(Target encoding bitrate, bits per secondqualityintEncoding qualitykeyframe_frequencyint#Maximum distance between key frames optimize_fortarget_bitratequality?keyframe_frequency@Default optimize_fortarget_bitratequalitykeyframe_frequencyDefault optimize_fortarget_bitrate5 qualitykeyframe_frequency@DefaultN conn=op=5topic=/camera/image/compressedDepth/parameter_updatescallerid=/camera latching=1'md5sum=958f16a05573709014982821e6822580hmessage_definition=BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent type=dynamic_reconfigure/Config& conn=op= time=[S#l png_level  depth_max$@depth_quantizationY@DefaultS conn=op=:topic=/camera/image/compressedDepth/parameter_descriptionscallerid=/camera latching=1'md5sum=757ce9d44ba8ddd801bb30bc456f946fmessage_definition=Group[] groups Config max Config min Config dflt ================================================================================ MSG: dynamic_reconfigure/Group string name string type ParamDescription[] parameters int32 parent int32 id ================================================================================ MSG: dynamic_reconfigure/ParamDescription string name string type uint32 level string description string edit_method ================================================================================ MSG: dynamic_reconfigure/Config BoolParameter[] bools IntParameter[] ints StrParameter[] strs DoubleParameter[] doubles GroupState[] groups ================================================================================ MSG: dynamic_reconfigure/BoolParameter string name bool value ================================================================================ MSG: dynamic_reconfigure/IntParameter string name int32 value ================================================================================ MSG: dynamic_reconfigure/StrParameter string name string value ================================================================================ MSG: dynamic_reconfigure/DoubleParameter string name float64 value ================================================================================ MSG: dynamic_reconfigure/GroupState string name bool state int32 id int32 parent *type=dynamic_reconfigure/ConfigDescription& conn=op= time=[Sg#@Default depth_maxdoubleMaximum depth value (meter) depth_quantizationdouble=Depth value at which the sensor accuracy is 1 m (Kinect: >75) png_levelintPNG compression level png_level  depth_maxY@depth_quantizationb@Default png_level depth_max?depth_quantization?Default png_level  depth_max$@depth_quantizationY@Default& conn=op= topic=/rosoutcallerid=/camera latching=1'md5sum=acffd30cd6b6de30f120938c17c593fb7message_definition=## ## Severity level constants ## byte DEBUG=1 #debug level byte INFO=2 #general level byte WARN=4 #warning level byte ERROR=8 #error level byte FATAL=16 #fatal/critical level ## ## Fields ## Header header byte level string name # name of the node string msg # message string file # file the message came from string function # function the message came from uint32 line # line the message came from string[] topics # topic names that the node publishes ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id type=rosgraph_msgs/Log& conn=op= time=[SE%[S) %/cameraCompressed Depth Image Transport - Compression requires single-channel 32bit-floating point or 16bit raw depth images (input format is: bgr8).w/tmp/buildd/ros-hydro-compressed-depth-image-transport-1.8.21-0precise-20140617-1547/src/compressed_depth_publisher.cpp!CompressedDepthPublisher::publish /rosout/camera/image/compressedDepth4/camera/image/compressedDepth/parameter_descriptions//camera/image/compressedDepth/parameter_updates/camera/image/compressed//camera/image/compressed/parameter_descriptions*/camera/image/compressed/parameter_updates /camera/image/camera/image/theora+/camera/image/theora/parameter_descriptions&/camera/image/theora/parameter_updates* conn=op=topic=/rosout_aggcallerid=/rosout latching=0'md5sum=acffd30cd6b6de30f120938c17c593fb7message_definition=## ## Severity level constants ## byte DEBUG=1 #debug level byte INFO=2 #general level byte WARN=4 #warning level byte ERROR=8 #error level byte FATAL=16 #fatal/critical level ## ## Fields ## Header header byte level string name # name of the node string msg # message string file # file the message came from string function # function the message came from uint32 line # line the message came from string[] topics # topic names that the node publishes ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id type=rosgraph_msgs/Log& conn=op= time=[SZ%}[S) %/cameraCompressed Depth Image Transport - Compression requires single-channel 32bit-floating point or 16bit raw depth images (input format is: bgr8).w/tmp/buildd/ros-hydro-compressed-depth-image-transport-1.8.21-0precise-20140617-1547/src/compressed_depth_publisher.cpp!CompressedDepthPublisher::publish /rosout/camera/image/compressedDepth4/camera/image/compressedDepth/parameter_descriptions//camera/image/compressedDepth/parameter_updates/camera/image/compressed//camera/image/compressed/parameter_descriptions*/camera/image/compressed/parameter_updates /camera/image/camera/image/theora+/camera/image/theora/parameter_descriptions&/camera/image/theora/parameter_updates7 conn= op=topic=/camera/image/compresseddcallerid=/camera latching=0'md5sum=8f7a12909da2c9d3332d540a0977563fmessage_definition=# This message contains a compressed image Header header # Header timestamp should be acquisition time of image # Header frame_id should be optical frame of camera # origin of frame should be optical center of cameara # +x should point to the right in the image # +y should point down in the image # +z should point into to plane of the image string format # Specifies the format of the data # Acceptable values: # jpeg, png uint8[] data # Compressed image buffer ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id type=sensor_msgs/CompressedImage& conn= op= time=[Sna%_[Sn$imagebgr8; jpeg compressed bgr8_JFIFC   %# , #&')*)-0-(0%()(C   (((((((((((((((((((((((((((((((((((((((((((((((((((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?xhEgڴlAh2jڊͳ(kQEƍ;eVgj[J -Ľ*KP½*K0%ERƵ(JW T)vRcڜ֜<-0 ¨ Sҵ%pV.*䰕=8Qpm=})(RHcqJ)vьSM)h-@ H G@4 QM@ KIE-(4Q@Q@Z(PE%4PIJ`- IM4fFi)(Ԕf.i)((RPE%- @-PE:) j]՘TB">7ޱ ֶ]AZJvl[/-$Vź(C.¼U&"2H MzTR`G0\AiSѶ.xS*m5QKaRYZnڳ$eMDE(0O#ғSJ`:@%-RNԀ梥SKKh9- (h@-RPRf h&h@ LRf4RRfIL@ JCFif4f4Q@QHJ(`-%%4Rf撌\њLњB4fcQH)hi›J %Z*b*@|^U8Eh]@"t3ַm8E!VժHٵN;G{UJWLZ-!PE0#QEC,{R0kH2Ǒ 3Ȥ]0iJhh-Ph R Z))i1H4SA 3KMJ)(IZLHivi &h.i  (PIFh4f4f4f3@%%%:44h JLFi4f4f4\N2RSE(%Z.]*Tݥ`WW;W~XUl;;+Ljk8:Ƿ̅?]EW#HKsaqZVy.o4$cH, h\C)^8; +Vxv0>VҴ56 QOHS0E&*LSHc4m-%RSI@JVe树3JT"EJˊae1@ĤAKE% (((4f4ў)CI@ IEQE)(JJ@:3I@!%-43@RRf@%&h.i3I(sE%\QE Q@J( ;@*0ih"Ueu,_x sTuitYeF_P*#IQD@2]Jcr/ !y?Ǧv:d'AgXo]}ZGY.JO0)Tk&6if=--7Эy!zנx!vL'˯:lx d <8 b֮F5otrkߌV'4ۆi%a"1 -QIU" R@MNiiHiƚhө$Jj !HEFi)m2~)1@KJC (EP!(E E.(% (ZLP! (PEJCJi1LAJZQHbf(4((JZ)(QE0 ZJ)RP(E-%Ni(E\URQiWߋƟs%Ɏy!}^}jاWm@x Ƕko '<5uWb|5߱r0O~|KU1s9^|-Ķߏ4KC?rN'ڠ]=8)uUCC?}S п(ax>*ݞo M9~)O?E7$>—$&Åߡ\k֧hz}ccJc>x?g.,=mt+N|Lz<"3z*} X<FO𱴣?]FS1%Dш'EC3iv=&A&c?49 s鶢>Ҳz4Y*~ Rz x?t=7+I&F> 9C#]rN7 li77&> qAݏxj't1UMq[*8?^XxgθXxç8bebIvoX!<Z|uy#U[eU@:xh#EǍ;ѥßKxBˮ?Rdl{ i.ßfxÇbkty+eS74tc~#V?xZ,z\|k,F?"c A_K9^\#6C81fȨb ;!-s6⏆xGcM>E| 4 %~ͯ?Ɠb\#xnsE~'#XC| MHO|=AOx{ٳk>a[Ut]27I Һ] %'h|OfxDMJ;,_1?xXBp3(Og*ayުC~ HK 2cN?+Fu\jR?ses:sohS~ɮúI%G-{)¬`i~ߨv;}?|Bo  f=`9K$LJ<96#(ɉ;#M_{@S-fS^*6+M k&Yb~y0+?h̥[+(((ifp{y}s\Kjrzja}őTsmsԮ Vڒɗi\v6Y D5Ǚp9&͚alU$.aKS zRi❻ MiqQ99'ZEi25Wu)lұQhI X=*S&(4mQ3^7L7[1\@C(U'uBv,.2_*Kԥ9jέ\w8\4 7ۚkck> ܟUS&?JLC"aPL@;@7ZJ M֦~POQ5HP265{u۩4ɦӘV~rm!NԷ٤ QCZڦEs˒y⧼sk2y3%IݟSªQQNjM#1Yaa;hm!솅gޔFiKs34 ѧQ ByhHH 3&65/E6Fd{aH-, O$2i֛Pz(QEaF8JVn(%)*Y6mg"!iM&i  4SMTC CKHi64ZyfRMJiJbƆ! t5̞J|zVg~H4Qa+K2$SGJp41@bVQ]&EP#KV)ij`t|0zOWxdtNc~䗯5WG W7PjSVv595Q?"iFcR04ʊDEyZVhE15 󚉅2[#a3RB֚/qzRbq@aM04捋)sE` #5$!4xUi&XIu2Ijrwk0a%R:Š8s@B sS1wK IUjP53,mO BvqQiM%36M:jcii)iJSLcکInoLl3-TjO\~t8 83j6]NjS+Dϟ4qNVU8"SLw'3֜z4hp֡O4`?k[X9^o4  zֽcK_Gsup#?~R9<{Wt|Q1);9NrԲzmݔlvR@4#1J:A9yUVbc(5*Yyh5+Up)Sc\$ Zҩ$vw❱9`_$AZu$REMaژO* 1n)Ah =^D#%N(-Y75J*yVE~ZM e"Tk5r@MåK#XUv-޵FWb=*Ye7aN\m³m"OJWcF^ƟXkvg=Ѣ+(=Ҋ?JsX;-E0k5W~+k[sF|O&0j8G3Z44ɩ&BGzG$sA9mC&zU$Z R~gؤ@*x ڭ5q9v!81)sQ74'qbE+rii1Q6jWz,R) + niOcQeG"UjTyMXMZT"nY2FbR-S<lZG+N%[60M0:k4{1wBQ(b`M&i(bnM!&>!4RS%HM2ii Zi62qL&VdcL&lsRFmP:٭\*.ÓZ5vU]3ه =l3KXZ֚(8Ӛ,u7q &iNi4lZLdICLfIIBh-CHM!4l 4M!4IGZkd،j3֕e!̔/i2MlY1Zq׫Ȯ,FT S@UcnPǭ8fSWjU zӳ+/J:TCzk}EV!EP^AAs -S/oMrV~p3Z\heR EHs>G: YC }"-k&ZR0 w+"PA(8jE0w4U9&Z_sLND&H^n*6[қI ȅ48Tl3L{M [ӽ"hvyzTxELn#qژyYMFENE@i$DR=3\a5$qBM\8sd$XN|FGy5.XJl^#2;j=*V5r ROJW,۰H:+nh%q[:VPҤYH*"40Zz8 P1ivJ99h)TQEHƘiDJG5doQO~j6.*W5 ZKG^:Wƻ@y.,1ְN08JvSrGna(XEfMƴ>ndAHqHAj5r7hIWc7$)TQfm6n&x'4M4̜FdvfcTdqTlتFR]Ԭ^Դg婳xшO,oj)@ZGR.f(JFEQž1jA@ǁ8 hOO8hh#Zii[M@{9?י{k|>2~{M9OzTs H~59q=Q̃1О\Gwo0-5 +fj: ̧FO+?6s~*9Vyr:1 RnMJ|fB*!j7@TY* d:ph£"d<+Z3 sm44l!aژW;.)jr F0*B)x44=SJQdLr80sңe=bFOjLҚE3Drh Sl&ƑQ1ntg`ިiITq]d#"Q [74 *To՘&؟d:Ttz*v3nq-MbacKTt $=,*1jn;l_1A>šeOܰ+ E?6«#G.E*2Kr}qUVLftkemkGؗҚm,h^V 5x#:%IGu8G5^Kgʗ)5+-q0*khģ 0i(Έm/IN[xU'dZŅ_ylȬ֥H D 1Qk\ǕY!Xk_ g~*)v+}|?!/UV+KL6c/R6¬HEb ?M6e~*R#<,'جe~*ZiLΟd4Xu®E _` {SNmۯU)P#i t a4i Wq@K@^Ӧit??ZDTeit3i M:VJO)fwN@;)A:oV)1@GxΏNӢh%8T ")t=4nbhJM E4 rztkg2HG\}R5BEurk)*"ΘbCE#go!ʭYxX/>HHiGoΗF1>y}T|Oq4<1\I-"̓ $1G[|>%.H-/cn߬jo_zfI(i%Xѳ5M6;=^Ub6#C_T7CgEϻ`Ϡ4k, /):SLG?-_",coJ ZC?ý̍49kʾ4}⏉8'W _|2:n[s[{CSҢ9>Ly}]r[FcqНwj%ʑ"(Y~OG2=Vi3CIsO }j>m4kt'#ѹ}YstÏB+<lFk[&{s"OGZZ\~BEIHEc1I DRb"F)qIm4)1RMFE!Zn(SHDE&*R)h2)TRH"VENL"M""E0CNi4M4m%-% њJi4M4S%*1 ٩Gt?vi%L%O]ƣ=*SԮIX5pN吜њ ?;d-ݵ]76yHRf֓p4|+ ]T Tm 0`/=3*S8۠Vq*dp+_U Jg8( -1Cv9+;F7䏐Wkop*g+wi|q`T5UJZSyGֽF?(,ڲA]ZIt6ShUz ؏=I8 ©yudxZ:My c@ΜU݂Z+R׵-JCgFikjd_2x[G:׈]'8LʭJ%ԙ 5kWr)| i3ygXsyi}ٶ7гEVC4 \ILou'Nd/q18PĞ >?t@M@J5jp4a) ygB5%Ѥ}GVy[RWkRW{Rk.Z}ڭj&ʶq %Òu+Et(sip= ƖX* fo[\&3{ܽlm<9!ytzCeQ֢KAMB&U <Hx89H#{ Ε~fih[W/iU@繭"vovIB"՘DV"^ ?/^b~Q^o5#lhFح;I,rmp7>Z=>6s W\lg/1fe%cgg`<'?\&{X5w'M6g?*MRrnO=js j^|5=wySQk#b#94۳3?ki3f3\6!Ini)3Hb)g|6ץW,":s ^IJI -N+V6ڨ#|ⴧ&{MMo,{Kw*_Fx-^5aח0BfnVysJ}۾M4Rbib)h i1N"Pi 8PqHiR`?ZB))RSMc@ 44j2h&Ɔ54\ &ƀM0Bii3L&HM0ijBh4ƧLc@ 4RiI&Mi1iM0;4Y4e_0Y)\Pf8o$v8ֺ[I/ձRxnxz^ՠbjbY)E*2PycɋEu+Sͮ[cTCVן c I[[wySR+[~6=<~ `8 [z-VVjFww#WqX]#+L+S␭"I+H5Wb%-p~B滽:IlBq++%ơtj56]͠o(ok؋FaNCWcƚ(/}A#]~zf{dpA6$eP,lw1w``$%۹s+|Z|JU<׃dЪ=T2 fO_r٤I$ m{W P#꺃;Z+B$w%;w7Díw(ҮW;HbyJlʧ]9F׊]V3O)Jʯh#35I騍[f;zX>W)5²򊲧[#HҪ~u ЗۺsS٣5 2 ґIbFrKg&1'*ݧ6(1f+zI dWS_4vzd5ډN+֛zj$:=wdr½oClŸJ%^TPbѯCNTA.VlY<ʭ`Z=/UZxp48#ʶzR RBzN _jV_,KFzY-ߝ+Css"@Kv7*#(Msz3PwֹO9 zTJn#Goq>u=Ip*#ә\֕/U,WuK%,Ѱ,*1I{GӤS_^󢸌2sKiq^ߐOF[yؓLi8;7#S+)?Tݘ\ʠ 1eTfe btT̄WF=;z׽q֚`2kNqkqLRys\7~mt`0.QL.jX Hi &iҚnh!4ii7SI& M0RiJM0 &4h7Su&&iA43Fi NCpj\`怹(4PzXJ3TNf3xއa ΩoxF?+sWOj*zV׹ +FXacQLgl5vI9PJQpX&1c T9=j(-٫x͓έ l}4#[[n(dEA\ԭcf[1$ϫŋb1{k4-sN>aA@-yf>("I'l#x:K{I>|icS"p!V sRꖢX 9aaֵΦoy ֮tW_5cl/D#?cWwW mzA1WS߭`9@?:ű 0\Ԍ 4Қa4!4JƘMBiHM&i3IL4M4Ҡ$4P^ D]R閑坦W<+S}q('FEkC;~'M#p /;a)9"n)t3;~c 'Q9Ɵ?<њ|s3?u/LL jwRfv g֙/=U-s\fF)3; }eߌt& 6 kO SqLJGũ+=ʴ^D~Y7T4QEr _@ˑ\}c [wcԬ>Fۊ@ULۃGҨ*8[IfPۏmvmēL Hqv K&ǽ78'*) N |͸%_#:S0fɨb[91Nk_k>?T*I - f`?TŎ~j& jAW^ॺ0/is}]LCsLcjx> ?^jJ_[>8<4*A?E[>q;NG}ޥu{c <<^X?)%f9Du`ָGc* Wך 9.-NG \#==ѡ]%q\=bZ"9ULd ']Wg#kn$ƣ309 fN{Tr+9^H N ,#'A4>J?:M;aI㊎\bj&ycUg>j\Dw $xF\>f Nj'vSnpid8ANig֑qҐz]l lN `!VjM;STW'd ~ڰXmEߠ/\fFu]rQuMIcS~~ +:\2!O{a]-ZDP@tA5۲46q.bՂ1SM4%d; Hii 11CP9(4IH vIQp=jSn{j4 šiF6,AF)E-P " %sHBNkBt3,S\Nǔh H\O3'$N;d>R[P6bn`?w*-ynrVY _B GheP*@QqKVo/JOYg¢tdS\D_R%{3`FYHa-wA7%b@5.sjŭXߍLZpGyn`} OVz\/R%=냏V]Tަ;eJֹ85 {քZAcm+taS#ҹi~t4[NYJǘ$c'+r=VPv2Z_هq&p:.,RYW22Z.-$i}.xX?\IZl[Z)pj iֺYCZ6Rae!Q1Hi\ls[ l's[v*ѳ)2*L-4 4)i7RSH4N ]S+D/Xb;ƣaU,+|=qW%j$+SDQJң[!UsȪ _!_V5}:@f ~:-Sjgz9F J9o4G& Z`'@.i e AEZb,Te8֐z ɷf@]b@ǩ z i, conn= op=topic=/camera/image,callerid=/camera latching=0'md5sum=060021388200f6f0f447d0fcd9c64743message_definition=# This message contains an uncompressed image # (0, 0) is at top-left corner of image # Header header # Header timestamp should be acquisition time of image # Header frame_id should be optical frame of camera # origin of frame should be optical center of cameara # +x should point to the right in the image # +y should point down in the image # +z should point into to plane of the image # If the frame_id here and the frame_id of the CameraInfo # message associated with the image conflict # the behavior is undefined uint32 height # image height, that is, number of rows uint32 width # image width, that is, number of columns # The legal values for encoding are in file src/image_encodings.cpp # If you want to standardize a new string format, join # ros-users@lists.sourceforge.net and send an email proposing a new encoding. string encoding # Encoding of pixels -- channel meaning, ordering, size # taken from the list of strings in include/sensor_msgs/image_encodings.h uint8 is_bigendian # is this data bigendian? uint32 step # Full row length in bytes uint8[] data # actual matrix data, size is (step * rows) ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id type=sensor_msgs/Image& conn= op= time=[SUl%.[Sn$imagebgr8 3'!4(#6*%8,#7-$8.&:2&:2'<0)>20>34B77C8:F;9I>3+@4.C7/D82G;5I?:ND;RF?VJAWOCYQGZTI\VK_WMaYNbZPd\PdaRfcTheUifXliZnk^ro_spaurdxufzwg{xg~zh{h}klmqrvwy{|~3) 4*!5+#7-8/:1:1 ;2'>3(?4+@4.C7/C93G=4K@7NC:QE>UIAVJEZNG[QJ^TLaUMbVNbXPdZRf^Th`SiaWmeWogXphZul[vm`xqbzseyvh|yg~zh{k~mnptuxz|~}~~3)!5+6+!8-90:1 :3!;4"<5#=6%?8'A:*C?-FB/HD3LH7OG;SK@VNBXPEZTI^XKaYLbZL`]Nb_PdaRfcSkdVngUpgYtkZul]xo_xt`yue|xf}yh{i|k~mnpqstwz|}~}~!5-"6.!5-#7/#60%82&:2';3&=2(?4%?8)C<*C?.GC0IE4MI;QI>TL@VNDZRH[UK^XL_YM`ZOb\Qd^Re_TgaUjdXmgYnh[pj^sm`uocxrezte|xg~zh{j}lnoqrswy}~ 4,!5-#7-#7-%9/&:0%:.'<0)>2)>2*@8-C;,C?0GC0KB3NE7RI:UL>VNAYQFZWH\YL_YM`ZOa^Pb_RdaTfcUifXliXokZqm^smavpdysf{ug|vi~xhyj{l}noqstwy~5*6+8-8-9. ;0$;0$;0)=3)=3+>8.A;.C=1F@0JC4NG6QF:UJXQFZWI]ZK_\Ma^Oa^Qc`QecRfdSigVljVokZso[tp_xtbyuczvf}yg~zg|i~klmostxz||2,4.6/70 80 80$;/$;/(=1)>2,A5/D80E93H<6M<:Q@3(@8+C;0D<4H@7L@;PD;OE?SI3&?4+A9-C;1E=5IA7L@;PD8QF=VK=VRAZVD]YG`\G`\Ib^Jd]Lf_OfbRieWkhZnk[qi^tl`uobwqdxufzwh}wjykzm|m~nprxy{}}~ 4*!5+ 7,!8-:-;. 1(=1*?3,@6/C91E=5IA7KA:ND=QGAUKCVPH[UI]UL`XLbZMc[Ld\Og_Ph`SkcZnf[og^pm_qn`tqaurdxvg{yk}zl~{mzn{q~ruxyzz{~3+!5-!8-!8-;-<.=/?1%>3&?4-A9/C;1D>5HB7KC;OG3$?4,@6/C94F<7I?8LB;OE?THAVJDXNG[QI]UMaYLcXMdYPg\Qh]Rh`UkcXmgZoiWplZso\uq_xtczve|xi}zj~{m~nprwxz{|}!5-!5-#7/#7/"80#91!<3!<3%=5%=5+?5/C91E;4H>7L@;PD>SGAVJDYMG\PH_TKbWKc[Ld\Og_Ph`QibTleVngXpiXrkYsl^voayrgyvi{xk}zl~{j}loqwxz|~ 3-"5/#52#52$71%82$;0&=2#?2$@3)C6+E80F>3IA6JB;OG=QGAUKEYOH\RJaVLcXNd\Pf^PhaPhaQhdSjfTmiVokXsjZul]tpaxtbyue|xh{h{l}onqtt{}~"4*$6,$5.%6/&8.'9/%<0&=1#?2%A4'C6*F91D>4GA7JD;NH?SKAUMFVSJZWM]ZP`]Qe[Rf\Th`Th`TicVkeVngYqjZrj\tl^vo`xqdxug{xk~xlyn{p}ruwz|~~ 4*"6,"6.#7/#7/%91!<3"=4#>3%@5)A9+C;.F?1IB3KC7OG8SJ;VMBVTEYWK\[M^]Pb_RdaTfcUgdVheXjgVmiXokXrk[un\uq_xtbyud{wi}zj~{m|psvxz|~}#5+$6,%7-%7-$80&:2#;4$<5%=6(@9-C;.D<3G?5IA8KE;NH:RK>VOAXTCZVK]ZM_\Pb_RdaVfcVfcUgdWifZmg\oi[sl]un_vraxtbyud{wj~{k|o~rsvxz}~~!6*"7+#7-$8.!91#;3$<5$<5*=7-@:/A72D:6F<9I?RHAUKDXPH\TK]ZN`]Rb_TdaVfaWgbXhcZjeYlf\oi_sk`tlcvpexrgyvj|yl~{m|pruwx|~!6*#8,#7-$8.$:2&<4&<4'=5(>6*@8.B:0D<3G?6JB9MC;OE?SIBVLFYSGZTL^[Oa^Nb_QebRgaShbVicWjdZli]olYrn[tp\uq`yueywg{yl}|m~}pssuwyz{}!6*#8,#7/$80%82':4(<4)=5*?3,A5.B:1E=4H@7KC9MC;OE>RHAUKEYQI]UL_YNa[Me^Og`PhaQibWjdYlfZmg]pj[rn\so`wsbyueyvh|yl}|n~qsuxy||}#6*$7+%7-&8.'72)94)=3)=3)=3,@6.B80D:1H=4K@7ME9OG@PKCSNHXSL\WKaYMc[Kf]Mh_NhaPjcUjdWlfXmg[pj[rn\so`wsbyudzxf|zl~{o~rswx{~%5+'7-#7-$8.&93':4(<4)=5)=3+?5,C8.E:/G@2JC5MF8PI>PMASPFWVIZYK_\Nb_LeaNgcOhdQjfTleTleWnjZqm\so^uqawucywdyzez{h}~knqsuz|"6,#7-#7-#7-%91(<4)>2)>2)>2,A5.B80D:3G=6J@:ND3%>3*>4-A7/C;2F>4H@6JB8NF;QI:TM2)>2)>2*?3-B6/C;1E=2FC4HE6NG:RK:UL=XOA[TC]VIaZLd]Og`PhaQkdRleSmfTngWnjZqm\tm^vobzsc{td}yf{h~kmprt|~7,8-"9.#:/&;/(=1)>2)>2*?3,A50B83E;6G@9JC:ND=QG?VKBYNE[SH^VKaYNd\Pf^Rh`TjbVldYmeZnf\ph_sk`tjbvlfzrg{sg{xj~{j}noqvx}8+9,8- 9.$;/&=1(=1*?3*?3,A5.C71F:5IA7KC:NF=QI?UMBXPGZTJ]WM`ZPc]Pe_ShbTjbWmeXnfXnfZph]sk^smbwqdxufzwh|yj~{mprtvx|}7,8- 80!91%:.'<0*=1*=1,>4-?50C73F:8H>;KA;OG=QI@SMCVPIYVM]ZM`ZPc]Pf^Rh`UkcVldXmgXmgZoi]rl_tnbwqdysf{uh|yk|m~pruy{~707081 :3'<0(=1*=1+>2-@4.A52B74D99I?;KA:NF2*?3+@4-B6/D8/D83G?5IA6JG;OL>SMBWQEZTH]WJa]Md`MfbOhdQjfSlhVmiWnjZpn\rp]tpbyuczve|xh~|h~|lmpsvw|~8-8-%82&93'96(:7)<6)<6*>6,@8.B8/C93E;6H>9KA=OEBTJEWMFZRJ^VMaYQe]NhaOibRleTngTmiVokZqm\so`tqbvsc{te}vh{j}mpuv|}#7-$8.%91&:2'96(:7&:7';8)=:*>;*C8+D9,F9.H;3J?8OD3)@5,B3-C4.D5/E60E93H<5IA8LD>PFBTJFXNM_UKbWPg\NhaQkdSneTofUpgWriXshZuj_vkaxmg{sj~vl~{pruvw{}#7-#7-$80%91':4)<6)=3*>4+@4-B6/D8/D8/E=1G?0GC3JF7OH;SL?WPE]VL`]PdaRfcUifSlhTmiVpiWqjXrkZtm[un_yr`yud}yl~{ptvtwz{~"6.#7/#60%82';3)=5)=5*>6,@8-A9/B<0C=-E>/G@/HD0IE8MG;PJCUKJ\RQ`YUd]VfcWgdWkhYmjWplXqmYrnZso\uq_xtazve~zl~{qtvvy|}"5/#60$71%82)96*:7+<5->7,@6.B8-B<.C=+D@,EA/JA1LC9OG;QICTMHYRO^WSb[TgaVicVmiXokXqmYrnZsoZso\uq_xtazvd}ym|qtwwz}~8-8- 81!92&85(:7+<5->7->7/@9-A>-A>,C?/FB/IB2LE7PE:SHATNEXRJ\YOa^PhaTleTmiVokXqmZso\rp^trbvtdxvfzxi}{m~}ruxy}|9,9,8-:/':4)<6+?7+?7,@6.B8/C9/C91E=3G?3IA5KC;OG=QICSPHXUL\WQa\Th^Vj`XnfZph\pm^ro_spbvscwtdxui{xk}zn}swzz}8-9.:/:/!;4#=6(=7*?9-A7.B8/C;/C;1D>3F@5HB7JD;NH?RLCURGYVL^[Oa^QebUifVngZrkZtm[un\uq^wsbyud{wg{yj~|osvxy||8-9.:/!<1"<5#=6%=6'?8,@8.B:/C90D:2F<3G=5IA:NF3%>3&?4(A6-A7/C9/D81F:2G;5J>8LB;OE@TJDXNE]UKc[Ie`LhcNjePlgXok\so_vrbyu`yuazvc|xd}yf{i~lovx{|6273 :3!;4#>3#>3&?4(A6+B7-D9/F:/F:1H<3J>7ME0H@0KB5PG9TK?ZQE`WId[OfbUlhYpl\soZvo]yr\{s^}ub~yczg|i~jjloqsvx{}#8,%:.&;/(=1)?0+A2,C2.E4+E8-G:0J=2L?7PE:SH>VNF^VHcZNi`QkdXrkZso]vr_|s`}ta~ucwdyezi|k~lmorstyz~&9-':.(;/*=1+>2-@4+B6-D8*F9.J=0KB5PG9SL=WPB\UGaZNgcSlhVokZso^wsazvb~yczd}e~fhijjlprtwz{~#7-%9/&:0)=3)>2+@4)B7,E:-H?0KB5OH8RK>WSB[WI`\OfbTkgYplZso]vrazvd}yf{h}k~lsuwxvvuwyz|}$71&93(<4)=5+?5-A7-A>0DA/IB3MF8QM>WSE^ZIb^Me^SkdXpi\tm]vr`yuc{yf~|jklottyzz{z||~%91';3(<2*>4,A5/D81E=5IA3MF8RK9WRA_ZHd]LhaSkdWoh\so_vr`yuc|xf~|h~lmklrtuwwxz|%91(<4+=3+=3/A72D:0I>7PE5UI<\PAaUEeYNi^RmbZrj\tl_vrczvg~zi|oqstvwz|~&:0(<2)>2,A5/C95I?7OH=UN<[SCbZHg^Ji`TofWriZtm^xqcywf|zh~|mqsvwy{~%9/)=3,A50E94H@9ME8PH?WOA\SHcZMg`TngWplZso^vnayqd|uf~wk|nprvwwy{}~&:0+?5.D<8NF9VMB_VHfZLj^RngYun_wu`xvbzxe}{g|h}psvyx{|}©¨+;1/?56FD3=I>AMB>PFASIDVLHZPJZUM]XMaYOc[LfYNh[Pj]Qk^SkcVnf[rg_vkaxm`wl`ync|qd}re~siwjxnzp|v|x~ur|q}r~t~x~«©©©¨««ª­¬©$+!'.$-/*,.))1++3-%1++% .#+ )",%* "&$%' " " #'+$  #*-%  #1&CQFM_H_qZvr|x|~­­­­­­­¬(**, ,-$./&00)11*+.&%( ),#(+"$)$).)!.,(&,%+$.$ 0&*!'"%#.,$/-#!%#(&*($0+*%%#%#%%%%%%&&)-,7;:+0"05'io^v}­­­­­««««««­¬/$ 0%2&2&2*3+"3,#4-'3-(4.(4/)50+42,53.60/711931931932:43;53;55<86=94=;6?=7@>8A?8A?8A?9AA:BB9DB:EC;DG>GJDIL?DGJKHz{x¾¾¾«««««««­­«««««««ªª©$2'$2'%3(%3(%2)'4+'4+'4+,5+-6,/5-/5-/4//4/,60,60-9.-9..:/.:/0<11=22=43>53=75?95>:5>:4?=5@>3@>3@>5B@7DB9FEIG;FD-32! 888qqq~~­¬ìë«­««01./$47$47!45"56$56$56#13#13&46(68#45#45 340114 2506&7='9<$694657#8A4= 5>)>G-BD+@B/@A/@A3C@6FC7IF:LI:JG7GD199%--(/2\cf~}|¾¾«««­­­­¯58047/;>5:=45:,7<.6:.8<06:.7;/;?3;?348,8<05<25<26<47=58>66<48D>;GA/=?*8:)7?/=E5DJ;JP?HL8AE5>B5>B6BD9EG9KH;MJ7IF4FC3@?,98#,0NW[x|®­¯¯¯­­««««««­­¬­¬]dZ\cY\d\X`XYa[W_YW`\^gcXcaXca]fbZc_Z`_\baZec\ge\ge^ig]hfXca_jhcnldrmesnbqphwvky{iwyS\_9BE:>C:>C9EG0=<(,ALPow~~|}­¯¯­«««««««««lwnnypjyrfunkzshwpjvpnzthxuk{xlywjwunwunwujwujwuhzwi{xeyveyvl~{qtz}fji=A@??@AAB:FH>JL8LI6JG3GD-A>/?<.>;0::>HH^kqx{{~°¯­©©©«««««ª¯®buiathathathbuibuibtjbtjbtjbtjbuibuibuicvjbvlcwmaxm`wlcvpcvpexrgztf{ui~xmyuWhZ>F9*2%:A=@GC9KH;MJ6MI4KG2DA/A>*<9-?<)9<4DGUehu|{{~}««¬î®¯«©©««««­­­­¬®brhcsibrmeupcvpexrbwqbwqbuodwqdxpdxpdxpeyqayqayqbyubyudxvdxveyvfzwi{xk}zq}r~qq9H9%3!1?-7HA;LE7NJ7NJ7NJ2IE2DA-?<);8+=:);82DAN[_r{z{~­°ðﯭ­©©©©««­­­­­­¬dlfgoiirnnwsjzum}xk}zi{xlywo|zpxqypuotk~rj}qh|tg{shzwhzwhzwj|yk}zm|yjyrO]K'%4%9H96KE9NH7PL6OK6MI1HD0B?+=:*:7+;80@=,<99JKk|}{xz|~¯¯¯¯¯­­««««­­­­®®Zhc^lg`sgathYmcVj`Sf`TgaXjgZli]ng^oh^rb`tdpnwuuyrvl|yl|yl|ym}zq~ulzoHVK*; .1A6*;:0ABarsx|||~¯®¯¯«««««««««««ªUg]Wi_ZibQ`Y>TE&<-:)*E49XH?^N3XK-RE@+=(E[>YoRv|k{pr{qvup~yqzwsVeV1@1/2E28JG;MJ9PL9PL:NL9MK;JI6ED3A<-;6-93.:45A;;GAALJ`kiq}}{~­««««©©©©©©©¨Ke^Mg`Od^6KE1C9/A7PM>PM9FE:FHT`bjw{~~«««¬ë«««©©©©¨Nf^Og_Oe]G]UH]QK`TZk]`qccvhcvhc}i`zf`zf[uaL`X+?7#,=6UfRk|h{|~lyjO\M&4"-;):EPM9-;6,82.:4/>=6ED4DGGWZaqtw~«ªìë«««©©©©¨Ni`Mh_Mh]Mh]Jk]QrdYqb\tefyfexeizfk|hkmmoc{sUme!520?1Zi[ytz\iZ9F7,1D6:JG?OLARKBSL?RL>QK;MJ8JG5GD0B?.>;)96*92,;42?=7DB9JKGXY]kmp~z~Ok^Ok^Un]Zsb^xd`zf`wd\s`gwek{ilxklxknzmlxkhvkp~sfxu8JG 2B?IYOIYO4?=-867=B@FK?LJBOMATNATN@SMPM0-'>34K@-;63A<QKATN?TN>SM=RL:OI8LI5IF4GA/B<.=6+:3+72-941><5B@:JGAQNVdfiwy|WsfZvi`wdF]J$=%' %'2#=C1PVDcfPnq[syhw}luvsw4A8%0'9D;8A=>GC?LJDQOATNATN<6CA=HF?JHMY[frtw~f}lXo^FZC)=&5G/1C+4<.,4&'*!25,AAA333E@RP.B:'96$63$54(98-?<2DA9HG6J@8LIRP?PO=NM;%96!52%74(:71A>4DA9FD@MKIUW[gijyxt~cwgOcSFaC@[=1G0%;$L^GWiRD^J>XD7TD5RB(8- VYQ{}xR^X3?94DA;KHPM=OL9bgbknfX[S@JD;E?8JG;MJ@ROBTQDTQCSPCSPBROAQN?OL>NKQ=%4%  !0/3<@E?CH6;7#($@@;NNICJ@6=3)9/6F<;MJ?QNASPBTQDTQCSPERPDQOCPNANL=MJ-:8*75'42)64,97.@=0B?6FC;KHCOQMY[]jnkx|x|Urb*G77+ cgf̟utxEDH(*%,.)GPFQZP?OE9I?6CA=JHCPNFSQCVPBUODTODTOCSNBRM?QN<.;9+64)42*44/99/?<3C@5GD8JG?ORFVYWfldsysza|s#>5#BUGKMH.0+游{{vHHC69)03#;C5GOA>I@=H?>IGCNLCSPEURBTQBTQBTQASPCSPBRO>PM6FA:JEANLIVTXdfdprpx~E;:E<=H?@NIESNCURDVSBVSAURCURASPASP>PMmuh|eXQ+'%!49+=B4>B6BF:?H>ENDDSLGVODWQEXRCWTAUR@TQ?SP>RO5IA6JB:KJ@QPQ\`^immy{w}h{&"(5,RT@DF2 /1,=D:ANEFSJBVNDXPEWTFXUEVUDUT@TR?SQ=QO;OM:NK9MJ6KE4IC1EB.B?-?<);8+64)420823;56A88C:8EC;HF>KJCPOLZ\Xfhhvxsxp)@B  (*%BD?=F<=F<=H?BMDDPJHTNEYQFZRFYSEXREVUCTS?SQ>RP;RN:QM8PI6NG8KE5HB3EB0B?-=:*:7(61'50)72-;62@;5C>5FE6GF8KL;NOEWZRdgduvnyx~~\uqPdaH\YP]\N[ZQ[[CMM=HF;FD=LEBQJAUKEYOFZPG[QG[SFZRFXUCUR@TQ?SP4DA4FC6HE:KJRP9QO6NL5NJ4MI3JF2IE1C@/A>-=8(83$80#7/&93)<62B?5EB7GD9IF9KH.=6,;4)5/)5/*750=;1A>5EB6FC8HE9JI-=8)94(61(61,:5/=84B=6D?6ED8GF9JI.<7+94)9/(8.,;4/>72B?4DA7GD9IF9KH9/A>3EB5GD6HE9JI;LK=PQDWXQcfZlodwxpzzvg[vHg?^1O >v1| 3~%.#,$*#) &| &|)~&{&~%}#{%}&z!*~!&z#(|(*(*&+x$)v$/o2=}@P@PCURdgwo}o~}  02-BD?FOMLUSGYVI[XFZWFZWEYVEYVEYVEYVDWXCVWDUVDUVARQ@QP?PO;3C@5EB5FG7HI:JM;KN?PQDUVOcaXlj\tthrz{p_{VrA^7T1I7y)|'zzxz{}}~~|$+"}#$ !$&!}} yuupqrsrqo.4GRKV[hgtx}%#!*5,.21;?>DIEJOKFSQKXVHZWI[XD[WD[WD[WD[WD[WCZVBXVAWUBUVATUARS@QR>OP=NO9LM7JK6IJ3FG1DE/BC,?@)<=$:8#97"::)AA-DF/FH0GI2IK5KP6LQ:PU@V[N^aVfi`psjz}zòŰï²ů¯¯¯¯¯²įrd~Ii<\ <*n ~ }   #,%71=-926261515.4.404/3.2-1)2)2)2)2*3*3*3)2)2)2,0-1.2/3/41602&(~{wvvuu!s+0INY^lt|p~y|x9HA1+.A;7HG;LK@NIESNHVQKYTIZYHYXFYZFYZFYZFYZEYWEYWEXYDWXFVYEUXBRUAQTAQT@PS9NP7LN7LN6KM2IK0GI/GG,DD(BB'AA'AA.HH0IK2KM3LN4MO8NS:PUSUAVXGWZIY\IX^IX^EX_EX_DW^DW^CV]DW^BX]AW\AW\AW\?W]=U[9V[8UZ2SX2SX1RY0QX.PY.PY$PV"NTNS OT#OU$PV/RY/RY0R[2T]2T]4V_9W_;YaG]bKafTedUfe^nkdtqjwur}ttywx|zy~~ïİ¿¿ıôIJ±õDzįƵǷǷǸȹɰijǵɳDzƳǵȰîïĭ®òů¯¯¯²ů¯¯óôįðﮯ¯®nXu3P8k'}r  ,(8'717/503/2+3)1)-)-****(+'*(( ('!(& &!'))()!(")*)(( (!)!-!-/ 0%0%0'0%.)-)-0/103412!ust lh!qCF}bex:GM>KQAQTAQTFWVIZYCZVCZVEYWG[YM^]HYXARQBSREV\EV\DU\BSZASVHZ]B\\?YY?YYC]]B\\A[[E^ZD]YB[WD]YI][G[YFYZH[\F]YE\X?^V@_WB^YA]XF[]F[]G\^H]_G_]F^\G__IaaCZ\>UW>SU8MO5EH/?B/>D+:@'8?/6)2&/#$'(&)'*&1%0 . *+ #&%$$#&#'!!&,&'%###$'&"#'%'%"%#  !!$%#$$#((   &#/,.*2.3748-9/;5=6>98!@?">9!=8#<8*C?)B>/HD0IE3LH7NJ,C?1IA@XPC^U?ZQ@ZSC]VB[WAZVG[XK_\N]\O^]VdfVdfSdcM^]UhbZmgXljXljZop_tu^vv[ssWomZrpdysjyeyqfzrdwxi|}ol}|n~{o|tttwopqqvx|}nYw.L5l z#}+,#6%8+8*7,6+5(4&2%/#-,,)($$%&%#    !!   """$$&&'(*+++*+,-!/#1$1&3*4)327/4)+yjcl;@xQVu9GQ9GQ6DLAOWGX^GX^R]AS^>P[CS]EU_DT^IYcN\fHV`IWaLZdIW_HV^G\^G\^GX_EV]EQ`FRaIWfGUdAU`AU`FZeH\g=R[9NW;QV?UZ?PV9JP:HP2@H'?E(@F4PS9KN3DK@QX8NY1GR@R\=OY=JNERVGWZ>NQ@PSDTW?TV@UWAXZBY[CXZCXZJZ]L\_PY]PY]MVZS\`SbhN]cJ\fJ\fI]bJ^cPbeM_bTagS`fP\dUaiWflYhnXgmVek\kqZioRfdVjhRghXmn\opZmnXljXlj\op^qr\mn]noapo_nm\mn`qr^ps\nq\qs]rt`qp`qpdqodqobqpbqp`qr`qr_pofwvdvscurdtqeurdvs`roeywj~|ez{f{|g|d}y`zs_yri}zh|yj~{l}i|md~~hmmrrrqv{wwttvutvxwzyuxxvz||~~}aPo=Z%B}+(~%**1,3+6)4'2&1'.'.'*#&$$####     #$$$#$!'#)#+%-*/+03120%+{!qln#g$,p?ByTWmuKXdGT`KS`NVcJU`IT_EU_EU_DS_FUaDP_EQ`JWcDQ]>P[AS^>T_CYdC[h9Q^>O]CTbGPaCL]FQdEPc=S`@VcG[fAU`FS_FS_ER^CP\@JYBL[CMZCMZIQ^FN[;FWBM^APc@ObCScCSc>Q_WaFUaET`CMZ7AN6EQ?NZ8Q[6OY3NX0KU/JT9T^OVLT>LV:HR9HN9HN;KN;KN>KO=JN434*+/14666006857398>>:<87/80730,#43,=<&:8!5357"9;'=B'=B&=? 79#67!45(8;3CF.>A/?B,>;);84ED,=<"5/*=74GA1D>0B?1C@1C@,>;.?>1BA/?B2BE5EH6FI;LK;LKVN?QNFXUNYPJULMTPQXTRXWKQPGRPMXVN]\JYXGXYM^_P^`HVXKY[N\^N^YQa\RdZOaWZhcXfaVd_^lgXfaTb]WgdUebTfcZliZliTfc[kh]mj_olbro^lnZhjXfh_mobro`pm`ro`ro`qpevuetsbqpivuivudutfwvfwvgxwjxsiwrnypozqo{vr~yo{vo{vr~xq}wq}wq}wnzuq}xs~|r}{o~wqyp{n~yp}q~m|l~{o~rtrtvwzttwwuuz{xwyx{}~~}~~~~}{vvcyI_7{(l}!!0(7-8+600--(+&)'(%$              !" #%'&()+*,+..1/416-2~#(tig!%h59|ci~lyivktnwnxr|r}judq}fser~fskxivavbwcxcx`t[ozdsdshrhrnxlv_s~`tauZnycp|bo{`my_lx^l|aoap|`o{cp|anz`myfsco~am|dr\jzRcqVguXky[n|\o}Zm{Zm{TguZiu\kw\lv^nx\p{[oz`t]q|XlwZnyXjzWiyTfvUgwZl|XjzOfuJapOfuVm|Xj|K]oObxRe{NetJapJapNetRgvRgvJ`sBXkMayNbzOepRhsRgpQfoP`pM]mSaxKYpFXhPbrPbmOalN_mK\jG[mK_qI]oDXjDXjBVhAScGYiN_mL]k@T_CWbEYd?S^G[fL`kAU`9MX=L_JYlL]kEVd@Vc=S`?TcAVeBWf=RaAScI[kGYdI[fBQdCReL[oGVjGZhCVdAU`FZeS\>Ta?Ub?R`>Q_EWbBT_CWbEYd9PYQ_@Sa>L[9GV?LXHUaBT^QX@U^=R[;OZ;OZKW>KWANZ@NXAOY?LX;HT;HT;HT;HT:GS=JV;HT8GS8GS2DN4FP8MO9NP;IS7EO=DTDK[EKX?ER>FS>FS:DS<7B@7DB6CA5@D5@D5?F1;B/9@6@G1>D0=C-:@1>D4AG0=C1@?0?>(76-<;1?A(68+;>3CF/?B,=*76(59-:>.8?)3:-8<0;?$63);8)8>#28)7A)7A#28#28,- 1201-.35462312/-!53 2514)93KI.EG0GI.GP.GP0RN0RN/SQ0TR-QO0TR7[W1UQ8]W9^XAa\GgbMlcLkb@f]DjaDjh?ecAcfOqtRsrMnmTtpWwsSsnWwr[{v\|wXzvXzv^{dhhl~l~iyouwtvz{wxxz°įóǏ~ywvxyu}}w~~|y~||}}xzxytsql~l~nm|m|sqeylo}jxrzt|nxmwnxmwislvlzftcrds]oasiwcqdq}kxgudrbq_n\s\sYq~^vUpzXs}Ro{Liu^tZp{Ykv^p{[p^sVqLgxDcuKj|NhvTn|aoaoco~_kzaiv^fs_gt^fsTamVcoPdoJ^iResViwVhxYk{UgwOaqSeu^pZm{\o}ZovTipTjuNdoQgtRhuP`pP`pP^mN\kRamWfrZgs[htXeqN[gM[jWetK_jFZeM`nNaoJ\gFXcMalRfqQepL`kLZdM[eW`kR[fSakSakMdmPgpJcmJcmMcnJ`kRamIXdKT_R[fU^iW`kLYeMZfMalNbmE]cKciKciE]cL^hI[eM[cR`hQ_gP^fTbjM[cK]gOakI[eGYcIYcEU_GWaN^hH[bI\cI[^K]`M\bGV\M[eN\fTciP_eO_bK[^M]`O_bO\bN[aNZbO[cP_eHW]DVaHZeAWbBXcCZ\BY[J_fH]dG[fJ^iAWbAWbE[hDZgE[hG]jFYgDWeH\gAU`BU\@SZBRUCSVKVZITXGRVKVZJZ]EUX@QW>OUPS6KM8MO6MO;RT6MO5LN3JL3JL2IK0GI3HI2GH3DJ3DJ8IO4EK9LM?RS=NO8IJ8IH:KJ=LK5DC1AD4DG.@C3EH.CD1FG0EG0EG,@E-AF/CH*>C(B 9=#9>#9> 9;4656787<B!:>6:7;7<9>7<.3(/'.(//6-8.90;(3,33:6:.2.22616-2-4/6,307-4)0*/.3/6,3+5-7-6.7,70;$1=*6%1)5*6(4%&$%!'%!%!%(+!'3++1+1$.#-)*6 8$Q)6c%7~1x0,#.,2+10/-,++''!" !                             !!!!)'+)/-0.01,-mifd^_TN:5'#!"%!$' %"(%'-(.+ ,$.&0,..0 ! !"0000:=:=7395'>:%<8'96/A>$78-@A.EG-DF2JJ/GG0KH3NK4MO5NP6OS;TX6835/.+*'%&$"$"$#                                "# *!+%,'.,1~-2799;=A|>B}@Ep>Cn8B^6@\8GS;JV9KN6HK9LM=PQ8IJ>OP?NM=LKBLTDNVEMZCKXBJWHO?JN:EI;IQ8FN1CM*G;C:B!=E#?G/DK-BI&=?#:<&=?#:<%:A'*9%4- )"(%+!$$'1<*5 !, *$/ *'.")  !%&&%"  # #""     ;˽οмͺ˺˼͸ɴŴó±Įz}zxywxyyzzvxwvxtuxuvvxwttwwxrprsrrspm}l|jz}k{~p{oz~p{p{k{~k{~l|m}hv~jxl{l{jzgwjyhw}gv|hw}fw}fw}ev|du{fu{fu{bru`pservhuyhuyervbougtzgtxhuyjuygrvbouerxfrzbnvantboudqubos]mp`ps\pu]qv`ru^ps]mp_or`ps`ps_nt`ou`ou^ms[lr\ms]ntZkqXio[lr_lp_lpcmmbll`im`im\im^koZioZioXlqYmrZkqZkq[knYilYilYil\io\io\im[hlXfpZhrZhrZhr\im\im_jn^im]gn\fm\fm\fm]go[emWckVbjXfnWemVfpUeoNcjNcjKdfKdfFaeGbfFchFchFdeEcdFdeFdeI`iI`iI_jI_jLahMbiIbfHaeIagJbhGcdEabEcdEcdEcdEcdEbfEbfB^fB^fB_iC`j?Xv@Yw@P?O7B5@38.3-+)'%!#                                       "$''*+2-426~489@z=D~?Ku>Jt>Mf@OhAV]AV]BZZF^^F^^E]]G\^DY[FW]FW]GU]GU]GU]FT\HU[GTZIVZIVZIVZHUYGV\FU[BTW@RU>SU=RT9RTQX=PWAOW@NV@OUAPV;RT;RT9PR:QS:PU;QV=QV;OT9MRX7Q4F1C04.2-+)''!%                     ~%("+'-)..|1147|9<Kq@Ms?Ug@Vh@]bB_dB`aA_`A^c@]b?\a>[`BYbBYbBYbAXa?Xa@Yb@[_@[_C\^B[]B[_AZ^AZ^AZ^AZ\AZ\AZ^AZ^?Z^@[_=[\>\]AZ\AZ\AZ^AZ^CY^CY^CZ\CZ\CZ\D[]D[]D[]D[]E\^E[`DZ_DZ_DZ_D[]E\^E]]D\\DZ_CY^BW^CX_DZ_DZ_D[]CZ\DZ_E[`FY`GZaIZaIZaIYcHXbIZaJ[bL\_M]`M]`M]`L[aL[aLZbM[cM[cM[cM]`M]`N]cN]cO`aO`aM_bM_bN_eM^dM_bN`cN`cN`cR_eR_eV`hV`hԽͺʻθˮƤÿ׽дDZĵȴǵȷǺʶɲųưðòŵƱ²ñª~}}}|~|zzzvwxwtvxywuvx{{ytppsrpl|h}~h}~f~|e}{e}{f~|i~i~h}h}d|zd|zk}mn|~n|~p|~nz|nxnxkx~kx~ix~gv|`u|]ryYuvZvw^w{[tx_s~`t`t_s~]ry]ry_vxby{h|h|fzdx}\uw[tv[tv\uw^v|]u{TmNg~FY:M7B2=-2',%"# !                            ~~}}}#!%!.~$1-7{0:~5Bw:G|33..)$% "#&&#"                       ~ | } ~ } ~ ~ } }{{{{{{{}|~" {%#~)'|.,.5|3:=H{BMLXtKWsI]hI]hI_dH^cI_dI_dH_aI`bK`bJ_aH_aH_aG^`G^`I]bI]bK\bK\bK]`K]`I^`I^`H\aG[`GYcFXbGZaI\cH]_H]_G\^G\^G\]G\]G\]H]^I[^I[^J[aIZ`IZ`IZ`IZ`IZ`IZ`IZ`I[^GY\FX[HZ]F[\G\]G\]F[\GX^GX^JY_JY_JX`JX`KZ`KZ`K[^K[^HY_HY_IZ`IZ`HZ]GY\HY_HY_IZ`IZ`KZ`KZ`KZ`KZ`MZ`MZ`OYaOYaLWbKVaHV`JXbHXbIYcIZaIZaIZaIZaKYaKYaӽҼѼϽϸͷ̴ɳȳȳȵȶɳʲɱȰǰðñİðï­­}{|}}||zzyyyyxxxxxxvuuuutsrrsrqqqqpomlllkki~h}g|f{i|i|k|j{j{j{j{j{j{j{j{izkykykxkxewhzYlPcBM9D33//*%'"#! $$%&'&&&&% !"!"!                      ~ } ~~} z{{zzzz{{{{{||!#'}(,08|9ABNxDPzGWnHXoH\gI]hI_dI_dI`bI`bJ_aJ_aJ_aJ_aG]bG]bG]bG]bF\aG]bG^`G^`G^`F]_H[bGZaFXbGYcGZaH[bH]_G\^J\_I[^HZ]I[^I[^I[^I[^J\_J\_I[^HY_GX^GX_HY`IZ`IZ`H[\FYZDYZEZ[G\^G\^G\^F[]GX_GX_GX_GX_GX^HY_HZ]I[^K[^JZ]JY_JY_KZ`KZ`HY_GX^CX_CX_EZaDY`D[]D[]JZ]IY\JY_KZ`KYaKYaJXbIWaGX_HY`FZ_G[`FZ_FZ_IZ`HY_IZ`IZ`վӽҾӾѼϻκ͸϶͵̳ʵʵʵȶɵʳȲdzȲǰŲǰŬë«©~}}|}|||{zzzzxxxxxxvuuttssrqqqpppppnnkkkkjjllj}i|k{l|n|m{lzlzjzjzi{hzhzgylykxkxlygt\iHV?M9<253(-"' (!##'&)),-++)(&&"!                  ~ } | } }} z x x { {{zzzy{'x-!~4*|;1@<|EAHMrPUzMXiNYjK^eK^eJ_aK`bM_bL^aJ_aI^`G]bG]bG\cG\cI\cI\cI^`I^`J\_I[^JX`KYaHWcIXdHZdGYcG[`H\aJ\_HZ]I[^HZ]HZ]I[^H]_H]_G\^F[]EZ\EZ\GZ[H[\J[\J[\IZ[HYZGZ[GZ[GY\HZ]I[^HZ]GX_GX_GX_FW^GY\HZ]HZ]HZ]K[^JZ]JY_KZ`GZaH[bE[`DZ_BYbBYbC[aC[aF[]F[]JZ]JZ]JY_JY_KYcIWaIVbIVbHUaIVbG[`FZ_G\^G\^K[^IY\JZ]IY\ͷ§v{jzo^p`XjZXhVM]KSaO\jXkq_u{iput|ǹտҽмϽνοоϻκ͹̷ʵʵʵȵȵȵȴdzƲŲŲűİﯯ¯®®¬~}}}}|||{{zzzxxxxxxxxwwvutssrqonnpppprrrqp~p~p~o}n|m{k{k{k{k{k{k{jzk{f{f{f{f{jziyhvesVeDS{7C3?/2),''((!+!+..////-,)($#                       }} |"~$|"z x w y x{zzzyzx{{!#*+|017>x6EJuPUK\pHYmH\gG[fE[fE[fE[fE[fE[fE[fI\cI\cI]bH\aIZaJ[bGZaH[bE[`F\aG]bF\aF\aF\aF\aF\aE[`E[`F\aE[`E[`E[`EZaEZaFZ_FZ_DYZDYZDYZDYZFX[FX[FX[EWZBX]BX]BX]BX]AW\BX]FW]FW]FX[FX[GY\HZ]H[\I\]I\]J]^I[^HZ]JY_KZ`N[_N[_MZ^LY]JX`JX`FXcFXcFXcFXcGX^HY_IX^HW]HV^HV^IWaHV`HV`HV`HV^GU]GU]HV^ܷe~z1VI .!   (8$E*#M1,V:6V=8X??ZB?ZBCZGAXEBXIBXIDYMDYMCXLCXLBXIBXIAXGAXGBYHCZIAXLBYMBYN?VKAYJAYJAXE;R?;T<9R:3H/8M4-B)4+"   +*VUE]DZѿоϾϽλι̹ιθͷ̹ʹʺʻ˺ʸȵȵȵȵȴdzưǭĭī¯¯¯®~~~}~}}||~}}|||yyxxxxxxxwwwvuuututssrpppoqrrp}n~m}k}j|i|i|hzi{i{hzfzfzfzfzfzfzbwVkBT>P3D0A*=':%5$4$0".$.#-"+ )'''%%$                                            ~ ~ ~ ~ ~ ~ ~ ~ } }}}|~~|}|}zyx v z y z yyyz| y$'37x>BFQwEPvGYkGYkI]hH\gD]gC\fC\eC\eI\cI\cM\bM\bJ[aK\bF[bF[bD]aD]aD]aC\`D]aE^bF]_F]_F]_E\^E[`E[`F[bF[bE[`F\aE\^E\^F[]EZ\EZ\EZ\EZ\CXZBX]BX]BX]CY^CY^BX]BX]AW\AW\BX]DY[DY[D[]E\^E]]F^^E__D^^C\^C\^E\^E\^KZ`KZ`KZ`JY_GZaGZaEZaEZaDY`DY`DZ_DZ_E]]C[[EY^EY^DW^EX_DV`DV`FW^EV]EV]FW^ճ˜p\trI]Z(<9 !',!,!-"!1&$=,2K:(N7/U>5]G5]G4ZC5[D@[C?ZBCZABY@BY@BY@CZACZACYBBXAAW@AW@AX?BY@BY@CZAEXDEXDEXDDWCGYBGYBD[BE\CA[F?YD3T?6WB/U?)O9'P8 I1>)=(6%1 ,"* &  ?A5klVoϿϽνκ͹̷̹ʸͷ̷ʸ˻̼͹̵ȵȵȵȴdzƳưŰůĭ¯¯¯®­~~~}}}}|{~}}|zzyxxxxxxxvuwvvtttuttsqppppoqrqqk}k}k}j|i{i{k{jzjyjyhzhzfzfzdxdxRgH]6I4G,@)='9%7#2"1 / /..*(&&$$$#                                                  ~ ~ } }{{ {|}y{{||}z { z z z y w uwwxxw|"(x+1=@wCF}JRnMUqIZhIZhD]gC\fC\fC\fI[eI[eK\cK\cG]bG]bD]aC\`D]aE^bD]_C\^F\aF\aD]aD]aD]aC\`E[`E[`F\aF\aF]_F]_F\aE[`E[`DZ_CZ\CZ\DX]DX]CV]CV]BW^CX_CZ\BY[BY[AXZAXZBY[DY[F[]E\^F]_F]_G^`D]aE^bD]aC\`DY`EZaJX`JX`JX`JX`HY`IZaDY`EZaEZcEZcEZaG\cF]_D[]DZ_DZ_DZ_CY^BX]CY^CXaCXaCX_CX_ۦ|:]W 0*  &"8)#H.1V<<_D;^CC]AC]AB[CB[C?ZB?ZB;ZD:YC9XB8WA7X=7X=6W:5V98W:8W:9X;9X;7X=6W<5U<5U<7U;8V<=W=W??X@YH;VE6R>'C/6!(  84,ibOҿпоϾϽνλ̺Ϲζ͵̶ζη̸ͺͺͶ˲ǰDzɲɱȲDzDZƱưůİﯮí«~~~}}}}|}}|{{{yxxxxxxxxvuutuuuurrqpppppoorqqp~j|j|j|hzhzhzjyjygyhzeyfzhzdv^oZkIXAP4C0?,9*7&4%3"1 /..-,)($$###                                                          ~ ~ } }{|||{||||~{{{ yz{{ w x ww vwzw!#~0/y98BItFMxHVmJXoF\gF\gD^dC]cG\cG\cF[bF[bE]cD\b@]b@]bB\bB\bB\bB\bD]aD]aD]aD]aE[`E[`D[]E\^E\^E\^E\^E\^E[`E[`FZ_FZ_F[]F[]EZ\DY[CW\CW\DX]DX]CZ\CZ\BY[AXZAYYBZZEZ[F[\G\]H]^H]^H]^E[`E[`EZaEZaEZcDYbFZ_FZ_IZ`IZ`GZaGZaGYcGYcGZaGZaG[`H\aJ\_I[^HY_HY_HY_GX^FW]GX^HXbGWaDV`DV`Țd/QM":8-+  /6"$I/+P62U@5XC9ZE:[F=^C;\A?[A>Z@=Y?=Y?:X>:X>:X?9W>8U?7T>5V;4U:3T94U:4U84U85V95V92T;1S:0R90R93T74U85V94U85T75T75S95S98T:8T:7U<7U<5S?5S?3U>4V?5W>5W>8X?8X?9XB:YC3J>5C8+9.#0-)=92D@9xlaͼҿоϾϽνλι̺͹̹θͺ˺˹ʹʷʴDzɳʲDZƲŲŲűijijİðﯯĮì}||{}}}}|}}|{{{zxxxxxxxxvvvutttsrqqprrrq~rqqqp~p~m|l{l{kzjykzjyjyjyixexfydvXjL]EV7I4F,=):)4(3(2%/"-!,-,++'%#"!!                                                              ~ ~ } }}}}}{{||~}|zzz|zzxw t tvvwz!z$'29x=DAQnEUrE[fE[fF^dE]cE]cE]cE]cD\bB\bB\bA]e@\dC]cC]cE^bC\`F\aF\aF]_E\^D\\E]]D\\D\\CZ\CZ\DY`DY`DY`DY`FZ_FZ_F[]F[]EZ\EZ\DY[DY[DY[EZ\D[]CZ\BY[AXZAXZAXZEZ[F[\G\]G\]G\^G\^GZaGZaEZcEZcDY`DY`DZ_DZ_GZaFY`FXbFXbFXbFXbFY`FY`HY_IZ`IZ`IZ`HY`HY`IX^HW]HW]HW]HV`HV`DVaDVaݺɜnB_\0( ))?06T:9W=D^BE_CG]AE[?A[?A[?=Z<+<(6'5(2&0)-(,#+"*()('#!                                                        ~ ~ ~ ~ } }}}}~~|yxy{{{!x ww t v uxxxy+&u94DGwHK{JUmKVnG[fG[fE]cE]cE^bD]aC\eB[dB[dC\eE]cE]cF[bF[bF[dEZcEZcDYbCZ\D[]D[]D[]DY`CX_CX_DY`FXbFXbFY`FY`F[]F[]F[]EZ\EV\EV\FW^GX_DY`CX_BW^BW^AV]BW^EZ\F[]HZ]HZ]GX^HY_JY_KZ`G[`G[`DZ_E[`E[`DZ_EWaFXbHWcHWcHWcHWcHXbHXbJX`JX`IWaIWaHWcHWcHXbGWaGWaGWaGWaGWaGVbFUaўw)BD +(J31S<<^E=_F?]D>\C>\B=[A4R>5SA5SA5S?6T@:RC:RC;SD6% ,'a\QɶѾѽнмϻλλκͻλλλι̷ʸ˹̶̹̹˴ɲɯƲȲȳȳȴdzƲųƱİñį¯®«~}|~~}}}}}~~}|{{zzyxyxxwwvvuuuuuutspnnml~mnml~l~o|p}p|nzkykykzkzkzkzfx`rTeIZ/7-5*1(/(/'.(,'+&($&%%$#!                                                         ~ ~ } }}~{{||yxz|zzwwvvv t w uwyx$%~65y>=ELqKRwIZhIZhG\eG\eG\eG\eG\cG\cF[bF[bF[bF[bF[bF[bF[bF[bE[`CY^CY^CY^DZ_DZ_DY`DY`DYbCXaDYbDYbFZ_FZ_F[]F[]EZ\DY[FW]FW]GX_GX_DW^EX_DV`CU_CV]DW^CY^DZ_DZ_CY^CY^DZ_IZ`J[aIZ`IZ`EZaDY`DYbCXaCWbDXcGYdFXcFXcFXcHXbHXbHY`HY`HXbHXbFXbFXbFXbFXbFXbFXbGZaFY`FY`EX_۹ċWmk;RN'>: & &0 >,)G34R>;[B;[B;\A;\A:[@:[@;Y?;Y?8Y<7X;5Y;4X:1X81X80X50X5.U5-T4/T2/T21T20S10S1/R0/R0/R0/R0/R05R/4Q.4P/3O.0Q//P./O0/O0/N10O2.P1,N/,N/+M..N//O00Q/1R01Q21Q21O51O53P34Q46Q35P25O55O56P66P66P66P63P:3P:4P<4P<4P<5Q=7P?8Q@9RA9RA9S?:T@;UAN3@4A.<,:'5'5%1#/"-!, ) ) )'%$#                                                    ~ ~}}}}}}{{||xxz{wyvwuvututuuwz&$w/-=@wFIIVoIVoG[fG[fG\cG\cG]bG]bG]bG]bH\aH\aH[bGZaEZaEZaD\\C[[C[[D\\CY^CY^CY^CY^DY`DY`FY`FY`EY^EY^EY^FZ_EY^EY^IX^IX^IX^HW]HV`HV`HV^HV^EV]FW^DW^DW^BW^CX_GX_HY`I[^I[^HY_HY_FY`GZaEZcCXaDXcDXcEYdEYdFXcGYdFXcFXcHY`IZaG[`FZ_EX_EX_EWaGYcEZaEZaEZaDY`DV`DV`s'JB )5K<6Z<=aC>_D=^C=[A8Y>8Y>8Y<7X;6X96X95X65X62X41W31W30V2/U1.T0-R0-R00S1/R0/R0/R0.R./S/.R..R.0O,0O,0O,0O,.O,.O,,O-,O-*O-+P.*O-)N,(M+(M+-N,.O-0O,1P-0Q/0Q/0O20O22O13P25P24O15M16N28M48M45O55O52N42N44M55N65O55O55O56P68Q98Q98R89S99S7:T8=S<>T=?SCAUE=TA2I66#   ;92ǸѾѾѾѾѾѽлλλλλκͺͺ͹̺͸͸Ͷͷε̴˳ʳʲDzDzDZƱıİððůĭ­¬|{{z||{{{zzywxzyxxxxxxxxxwtsssuvvvqj|fzg{kj~j~fzdwgzk}l~j~i}h{gzgzfycs_oW]OUCG@D7=5;)7(6%4#2!0 /+))))(%%!                                                    }}}}}} }~|{ xyxxwyuvvvtsvuuuvw"w' |40v@8aA:`B9_A9\A9\A4Y>5Z?0Z>/Y=/Z;/Z;4\92Z73X62W53V42U32U31T2/U1.T0-S/-S/-S/-S//S//S/.R.-Q--Q-.R.-Q-,P,.O,-N+-N,-N,+N,*M+*L-+M.)N,)N,*O-(M+*M+*M+.L+.L+/M,0N-1N02O10M/1N01N01N0.M0-L/-L/-L//K10L20L2/K1+L1+L1,M0-N1,M2-N3/M40N51O61O62P62P64Q45R56P;7Q<7RA7RA7RA7RA8SB8SBI6?4=.8,6%4#2 0.,*&%$%%#"!                                                  ~ ~ } }}}}}{{|{zzyyxyvvxvssuvsrtttw#t&.9AwBJKVnKVnFZeEYdFZeG[fF[dF[dEZaEZaGZaEX_EY^DX]EZ\F[]EZ\EZ\F[]EZ\EY^EY^FXbGYcFXbEWaGWaGWaJX`JX`JZ]IY\JZ]IY\HX[GWZGV\HW]FW^FW^EV]EV]EWZEWZHW]HW]HW]IX^CZ\CZ\DZ_DZ_F\aE[`FZ_G[`JZdJZdFXbFXbDYbDYbC\`C\`D]aC\`D]_D]_D]_E^`G]bF\aE[`E[`DZ_CY^BW`AV_͗g?b\2,!, 7$5L9?^ABaD@_B?^A=]><\=:\=9[<6Y>6Y>1Y=0X<1Y61Y63Y52X41W31W32V20T0/S/0T0/S-/S-/S-.R,.R..R..R.-Q-1P-0O,/O)/O)/O(/O(/O).N(.L+.L+.L+.L+.L+.L+-N,-N,+N,*M+,L-+K,/K*/K*0L+1M,2N-1M,1N+0M*0M*0M*/L..K-,L-+K,-K*.L+/L..K-+K,+K,,M+-N,-L/-L/0L20L23M13M13M13M17M18N29O2:P37O:7O:8P;8P;=R?@S@?=);YE4Y>3X=1V;3X81V63W32V2/U1/U1.T0-S/-S/-S/.R,.R,.R.-Q--P.-P..O,.O,/N+.M*0M*0M*/L'/L'+M'+M'+L)+L)-L)-L)/L)/L).M*.M**M+)L*)L*)L*/L)/L)/L)0M*.L+.L+/L)/L)/L)/L)-J--J-+J-+J-+K,+K,,K.+J-)K,)K,)K,*L-*K0)J/,J0.L21K11K11K10J01K12L23M34N43N63N63N63N66N97O:=P=>Q>@P>@P>6G3!2  35)ziѾϼϾѾҽλ̼˿о̾Ѿͽ̼˾;ͼ˼˽̿ν̺ɵȹ̼̺ʻʼ˷ʷʺ˽ѿοοννννννννννκ͹̵̵̲˱ʱʱʵȵȵȴǴǴǵȴǯƭĭƬŭĭĮîí­¬~~~~}{yywx{zyxvvsssqqppqssttttutonlllj~j~kkj~g}f|cybxUjH]2Z>2Z>3Y;1W96V75U63T23T2.T0-S/*R.*R.+Q-,R.-Q--Q--P.-P.,N/+M.,M*,M*.N(-M'/L)/L).K&.K&+M'*L&)M)(L(*K(+L)-L)-L)+L*+L*+L**K),I+,I+.J)/K*+L*+L*)L*)L*,J),J)-K*-K*+J-*I,*I,*I,+I/+I/-I/-I/,I,-J-+J-+J-)J-)J-)J/)J/-I/-I//I//I/-H0-H0,J1,J1-K2.L3.L2/M33K64L76M<6M<6M<7N=7N;4K81E5+?/ '"<73{̽лθͷ̷ʹ̶ɵȶǷȹʸɺɻʻʹȸǷƶǵƷȵƸǹȺɹȶǷȷȵƴɴɳȲǴǶɽ̼˽̾;οϽͼ̿нννμͼͺͺͷ̷̴˲ɱȱȳȲdzȳȳȴɶɴdzƱıİïįį®~~~~~}}|{||||{wvttsrttsstttttsttrqmlllk~k~l~l~l}k|g|f{`vTjIW9G~6B4@1?b@AdBC`BB_A@]??\>;^<9\:7Z86Y75X65X64Y75Z83[84\94Y93X84U33T22T.1S-/T,.S+-R*,Q),Q),Q).O,.O,0M//L./L//L/0J.0J./K*/K*1K)1K)/L).K(+K%+K%+J'+J'.K(-J'-I(-I(.J).J),J)+I(-I(.J).J).J),J),J)-K*,J)-J,,I+,K(-L)*I,*I,*G*+H+.H,.H,0H,0H,/G+/G+.H,.H,,I,+H+*H.+I/,H.-I/.H..H..H./I//H0/H0/H0/H0/I//I/0I11J23J73J74K84K87L97L9;N;;N;1@1& ![\L¿ŻȻȸǷƴŴŴű²óĵĵĶŵĵĴ󳯭ĭįůű±²óııİוּĶĹǻǼȿ˼ȼƾ;˿̷̿̽̽ʸ˷ʷʵȵȳƳƶŶŶŷƴɳȲDZƱį®~~~~~}}|{{yywvuttttsttsrttvvssstqpnnnno~n}p}o|n|m{h|dxSgFZ9F6C3=2<,8*6#2 /+*('$$$$#"                                         ~ ~ ~ ~}}}}{{{zy xyywwwwwwuutsrtqpqqqq) t3*~B9]?=aC@_B?^A?\>?\>=]><\=8Z;6X93X62W50X40X41Y61Y64Y93X84W52U31U10T0/S-/S-.R,-Q+,P*+O)+O)+O)+O++O+/M,.L+.K-.K-0K-/J,/L)/L).K(.K(,K(+J'+J'+J'+J'+J'-J'-J',G),G)&I'&I'&I'&I''I*&H)+H*+H*-I(-I()J(*K))J()J()J()J()H+)H+,G),G),G),G),F*,F*.F*.F*,F*,F*(F,(F,&G,(I.'G.'G.-F..G/.G/-F.)F0)F0)E1)E1*G1+H2)H2)H2)G3*H4/H7/H72H92H94J;5K<5K<7M>3J7#:' $"a_Rĭ˸¶±±±°¯°­¬ķŴŮĸɼ˿λʹȽʾ˼˺ɷʸ˷ʶɵȳƱƱƳƳƳƴDzDzDzŰï®~~}~}}||{|yyyywvvvuuututtttsuusrnnnm~mmml~m|n}n}m|hw_nHT@L5@3>*9(7'3&2$/"-+*''%$##""                                           ~ ~ ~ ~~~}}{{{zy xwwwvvvuvuussrropqqqqr!w7.uA8GKlJNoGWaHXbDZ_E[`DY`CX_CX_CX_EY^DX]HV`IWaIWaJXbEY^EY^DZ_CY^CZ\CZ\CZ\CZ\CZ\CZ\BW^AV]AV]AV]CU_CU_EU_EU_GU]HV^IU]IU]GU]GU]DW^DW^HV`GU_IT_JU`LX`LX`JX`IW_EX_FY`DYbDYbCXaCXaDY`CX_EZaDY`EY^FZ_FZ_EY^CXaDYbCXaDYbDYbDYbDY`DY`FY`FY`͑KZ`%96+(9*I&:^:BfB?`C>_B>_==^<=^<;\::[99Z87W86V74W52U30V21W30X40X44X44X43W31U11R/1R/.R..R.,P*+O)+P(*O'+P(*O',M*,M*,M*+L)-L).M*0M*/L)/L'.K&*J$+K%+J'*I&*J$*J$*J$*J$,I&,I&+G&+G&'H%&G$%I%&J&%H&%H&,H',H',I&,I&(I&(I&&J&&J&&J&&J&(I''H&+H%+H%*G$)F#*G$+H%+H%+H%+F(+F(%F)%F)%F)&G*&G,&G,(F,(F,(F,(F,(F-(F-&E/&E/&F-'G.*H/+I0,G/-H0-G3-G30G40G42I84K:4K85L96M:7N;$;(- #WQ=^<:^::^:8\86Z65Y55Y54X43W32V02V0/V/0W01X11X13W13W12V00T.1R/0Q..P*.P*.N(.N(,O'-P(,O'+N&+M'+M'-L)-L)/L)/L)-L)-L),L&+K%(J$(J$(J$(J$(J$(J$)I")I"*H!*H!*H!)G %G!%G!"H$"H$$G%$G%)G&)G&(G$(G$&H"'I#%I%%I%'H%&G$(G$(G$)F#)F#)F#)F#)F!)F!*G")F!&G$&G$#F$#F$#F$$G%$F'$F'$E(%F)%F+%F+'E+'E+'E+&D*)F)*G*-G+-G+/G+/G+.G//H0/F3/F31H52I62I62I64K85L99L85H4/8'  20#xdƾƼ¬ìµƵƱ±IJŴŷȾ;ʾʽ˽˷ʵȱȱȰɰɯȮǰǰDZƲDzDzǯĮíĭĭĬìë¨~~zyzyyyzyyxyyyyxxvuuuvurrnnoorrrrnmm~l}n|n|m{m{m{kyhucpR\EO9>9>2;.7'3$0",!+$+#* & &%#!!                                                         } }}}}}{{{zzzz{yywvuuuuuuqroqoommoont:7sGDNWoKTlFXcFXcDXcDXcEZcDYbDY`CX_CY^CY^CY^DZ_F[]F[]F[]DY[FW]FW]FW^EV]EV]EV]CV]CV]CW\CW\CW\BV[CV]CV]DU\EV]GU]GU]GV\GV\CW\CW\EV\FW]EY^FZ_DY`CX_AY_BZ`BZ`BZ`@X^@X^BW`CXaBW^BW^CX_BW^CX_CX_CX_CX_CXaCXaCX_CX_FY`FY`FY`FY`EY^DX]Ň9VS$!";)5V3DeBCeFAcDBaD@_B9^<9^<5]94\83[72Z61Y50X4/X1/X10X//W./W..V-0X/0X/0W0/V/0T./S-.R,,P*+O)*N()M'*N(,O',O',O'+N&+M'+M'+L)+L)+L)+L))M'(L&%L%$K$#J##J#%I%%I%%I%$H$$I!#H #H #H #G!#G!#G##G#!G#"H$"H$"H$#G#$H$#G##G##G##G#$F'#E&#G#$H$%F#%F#'F#'F#'F#&E"&F 'G!%F#%F##E&#E&#E&#E&"D%#E&#E&#E&#D'#D'#D)#D)$E*$E*&D*&D*+E)*D(+E)+E),C*-D+,E--F.*F2+G3-G3-G3/F3/F31H72I81H<1H<4I=4I=&3*  ,1#lȼ´÷ùźƹŷŹǹʸɵȵȵȴǴǴdzȳȲɱȲDzDzDZƯįįįįĮîí«||yyyy{zyyyyyxxxxwxwvtqqooqqppppmmmmn|n|m{m{j|j|\oQd?O:J.?,=(9'8$3 /+*))$$"                                                 } }}}}}{{{zz{zzyyvvuuttrrppmqon mn opoq!)r.6BOwANvDVfDVfCWbCWbDYbDYbDY`DY`CZ\CZ\CZ\D[]D[]D[]CZ\CZ\DY[DY[CW\BV[EU_DT^EU_DT^EU_EU_GU]GU]DU\DU\DU\EV]DU\EV]EV]EV]EV]EV]EV]FW^GX_GX_DV`DV`BW`CXaCY^CY^BW^BW^CXaCXaBX]AW\BW^CX_EX_EX_FY`EX_CXaCXaCXaCXaCXaCXaCXaCXaEWaDV`s:[S?#0<*R/?f?AhAAdB@cA;`>9^<6^:4\84]63\52[41Z30Z1/Y01Y.0X-/W,.V+/U*/U*0V+0V+2U-1T,2Q.1P-0O,/N+*O')N&)N&*O'+P(*O'+N&+N&*M%*M%,K(,K(,K(,K()J')J'%K'$J&$J&#I%$L##K"$H"$H"#G!#G!#H #H #G!#G!#G##G##G!#G!%F#%F#%F#%F#$F $F "F #G!#G##G#%H $G)G )G )F!(E 'E(F'E(F)F!)F!#G#"F""E#!D"%B$&C%&E"&E"%F#%F#%E&%E&%D'%D')C))C)*E'*E')D&)D&+C'+C'+E++E++F.+F.+E0+E0-D1.E2/F30G41G80F71F:3H<0E93'#83'lg[º³²³ƵȵȵȵȵȵȴdzƳȴɴǴǴdzƳƲŰůĮŭĭĭĭūé}|||||zzyxzywwxxvvvvuussrqqqqqqp~nnm~nm~m~m~m~j}j}h|g{VeJY>I9D.<,:&6%5 1.*)(&#"                                                     ~ ~ ~ ~~~}}{zzzzzyyyywvvvrso nnnmnmnmopoq!&x6>tBJBUiBUiDXcCWbCWbCWbEWaFXbDYbCXaCX_BW^CZ\CZ\CZ\BY[BX]BX]AV]AV]AV]AV]AXZAXZCXZCXZFU[GV\DU\DU\EV]EV]FVYFVYFVYGWZGWZGWZGU]GU]EV]FW^EX_DW^CV]CV]CV]CV]DW^CV]DW^EX_CV]CV]FW^FW^GX_HY`FY`FY`CXaCXaDV`DV`EWaFXbDYbDYbDXcCWb}>1%;(T38c7;f:?eA>d@=c?;a=3`;2_:.^8.^8/^4.]31\01\00[.0[.0Y,/X+.W*-V)-V)-V)/V)/V)/U*-S(1Q+/O)/O(/O(*O')N&*N(*N(+O+*N*/L'.K&-K$-K$-K$-K$-J%-J%+K%)I#'I#'I#%I%&J&&K#%J"%I#$H"$H$#G##G##G##G##G##G##G##G#"F"%E%E%E%E$F %G!"F"#G#"F"#G#"F !E'D'D'D&C(D(D&C(E %D!&E"#E$F #E#E%D!&E")F#)F#(E")F##D"$E#$C&%D''D''D''E$'E$)C')C')C')C')C)*D*'E,'E,'C/'C/+B/-D1.E2.E2-F5,E4-E6.F71G83I:9E:)5* KJ:}°°ñIJŵȵȵȴǴǴdzƶɵȴdzƲųƲűİŰůůůůŮĭê©~~~~~{{yy|zyywwvvvvuttstr~r~r~rronnnm~np~o}p~o}k~i|dvZlFT@N6A3>*8(6$3"1,+))&$#!                                                     ~ ~~~~~}}{zzzzzvvvwwwvvuuo mnolmlnnponnp+,p:;EMnFNoBUcCVdCWbCWbDV`EWaEX_EX_BX]BX]BX]BX]AW\AW\?W]?W];X\;X\;YZ;YZAXZAXZGWZGWZFT\GU]EU_EU_DT^EU_EV\EV\EWZEWZEV\EV\CV]BU\AV_AV_BW^BW^CV]CV]EU_EU_GU_GU_HV^HV^GU]GU]GU]IW_HY`IZaFY`FY`EX_DW^DV`DV`EWaFXbFXbFXbBVaBVa̙Spm(EB8 E-1[29c:=g>=g>=c?;a=8`<7_;3`;1^9/\7.[6-\0-\03[02Z/1Y.0X-1X+0W*-W'-W'-V)-V)/U*/U*0S+/R*2P)1O(1P&1P&-P(+N&,O'-P(0P).N'/M&.L%-J%-J%,I$,I$,I$+H#+H#+H#+H#+H#)H%*I&%J"%J"%I#%I#%I%%I%'I#&H"&H"%G!%F#$E"&E"$C &D%C'F(G)F!)F!)G )G $E"$E"#D!#D!%E%E&C&C%C&D'D!'D!%D!$C $D$D$D%E%D!%D!(E"(E"&E"&E"#D"#D""A$#B%#B%#B%%B%%B%(B()C)'B*&A)%C)%C)&D+&D+%A-&B.&B.'C/(D0(D0)E1)E1,D5-E6/D80E96F<8H>.;2) .2&}si´ŶdzȳȳȳȵȴǴdzƳȲDzǰůįįįįĮîí¬~~~}{zyy{zyyyyyxxxwvuussppqqppp~o}p|q}q}r~p~p~p~m{amQ]AK$#?%$A$$A$'B$&A#'A%'A%'A''A'(B()C))B*)B*)A,)A,)A,)A,*B-*B-+C.+C..C0.C03C14D27E39G5;I77E3', /(voc~ĶŵĶŶŴŴűƱƱƱưﯯ¯¯®~~~~{{zyzzzzyyxyxxxxvvssponnoop~p~q~p}p|p|p|q}r}r}o}esZbJR?E;A/9,6(2&0$,%-%*%*!' &"!                                                     ~ ~ ~ ~ ~ ~~~}}{{{{zz x xwwwvvvutr q m mo mnnnonmnmk#r40nEALTpIQmDVaDVaEU_EU_GV\GV\DY[CXZAXZAXZAV]AV]CW\CW\CU_BT^DT^DT^GV\FU[FVYFVYFU[FU[AT[BU\AV]@U\BU\CV]DVYDVYEV]DU\CU_CU_AU`AU`AV_BW`AW\AW\AW\AW\EV]FW^GU]HV^HV^IW_IW_IW_IW_IW_GX^FW]EY^EY^CY^CY^CY^CY^GX_GX_JWcIVb~>XX+$/KD@cAEhFBeC@cA"">$#?%%?#%?#&@$%?#%?%%?%#>&$?'$>*%?+&@,&@,'?*'?*'>+'>+)@-)@-)@-*A.*A.+B/+B1+B1+A2-C41D83F::F9+7*!&`ZEq³IJôǴDzDZƱį¯¯¯¯®®~~~~{zyyzzzzwvwwxxxwvuuvrqooonpo~o}n|p|p|p{q|pjz_rUhHV>L:@6<07-4+/)-',&+#*!($"                                                        ~ ~ ~ ~ ~ ~ ~ ~ { {{{zzyyy xxyvwwvutrqnn n n mnkmmnmloq'"k94}DLnEMoCU`DVaCV]CV]EV\EV\EWZEWZEV\EV\CW\CW\CW\CW\BV[BV[DU[DU[FVYFVYFVYEUXFU[FU[BU\BU\@U\@U\@U\@U\CT[DU\DU\EV]CU_CU_CU_CU_CU_CU_CU_CU_EU_EU_EU_EU_GU_GU_HV`HV`HV^IW_JY_JY_IX^IX^GX^FW]BX]CY^CX_CX_FV`FV`GVbFUa׭e/II7&7&2W7@eEDgEBeC@d@>b><`:;_98_87^76\85[74Z63Y53Z32Y22W/2W/2W/1V.0V+/U*/U*.T).T).T).T)-S(-R*,Q),O'+N&+N&+N&-N$.O%/P&.O%0N'/M&/M&/M&/K"/K".L-K+L,M)K)K)K)K(I(I)I")I"(I'H)I)I)G (F(E (E +F!*E 'D!'D!&C$A$D$D$D%E)E*F*D")C!$C $C $C #B#A#A#A"@"@"@#A#A#A$B$C$C#B#B#A$B%A &B!&@$&@$$>$$>$">$#?%%?%%?%%?%%?%$>$%?%#>&#>&">*#?+#?+">*&?'&?'&=*&=*'>+(?,(?,)@-)@-*A.)@-)@-*A0*A0.B20D43D64E7+7, ,!*.EI7rŶƱȰǯƬï®ïį®~~~~}||{zzzzyxxxxxxvuuuuppopoonno}n|n|n|p{ozn}fuReI\>K9F4>2<07-4*1'.$,#+(%#!                                                                      ~ ~ } }zzzzyyy xyywwvvutr q o ooommmmmonmml g)"p>AqGJzAScBTdCV]CV]CW\CW\EV\EV\EV]EV]CW\CW\AXZAXZAXZ@WY@U\?T[BSZCT[DRZDRZETZETZ?UZ?UZ?UZ@V[BU\AT[CS]DT^CT[DU\BT^BT^DS_DS_DS_DS_FS_GT`FT^GU_GU_GU_GU_GU_HV`HV`HV^HV^HW]HW]HW]IX^FW]GX^CX_CX_CXaCXaDVaDVaDVaDVa른pw)K4*90W=DjFBhDAeA@d@=b:;`8;`8:_77_67_63[73[72Z61Y5/[2.Z1/Z..Y-0V+0V+0V+/U*0T)/S(/S'/S'1Q*0P)-P(,O'+N&+N&+N&,O'+O$+O$/N$/N$/N$.M#.L%.L%.M#.M#-M,L,M+L+K+K'K'K'K 'K )J 'H)I)I&I&I#I#I$F $F 'D'D&D%C$B#A$C#B%A%A)B)B(C&A"A"A$A#@#A"@"?!>!>!>!@#B#C#C DC!C B"A#B$A%B%@"$?!#=!#=!!>!"?""?""?"#=!#=!#> #> !=#!=#?& @'"@'!?&$>$#=#%;$&<%%=(&>)%<)&=*(?,(?,&@,&@,)@-)@-+?/-A13B45D69E:1=2MLCgCAeABc@@a>;a6:`57_48`55_64^51]41]4/^2.]1-^-+\++Y++Y+1W,/U*/U*/U*0U&/T%1S'1S'3Q*2P)0Q'/P&)P#*Q$*P%)O$+O$+O$-N$-N$,M#,M#)M"(L!'M"&L!(L (L ,L +K,L +K*L )K'K 'K *J)I)I)I)K)K%J%J"H"H ED!DBCC!B!B%A%A&B%A&B&B!@!@#@"?'@%>&?%>$=$=!@"ACCBA? @$@%A(@(@(?'>#?$@!@"A!?!?!? >!> !> >! ?" >$ >$!?% >$=#=#=$=$='<&=)=)$>*$>*$=,%>-"@.#A/#A/#A/)@4+B6-B<.C=0D:#7-(8A'opSuôıĮðñ±°}}zzxxxxxxwvutssnnllmln~m}o}o}o}n|k{iy`rTfCQ?M5?3=07.5-2+0#.!,+)'&"                                                                         } }{{{{{{{zyyyywvvvu s p p o ommmmmmmmmnkmjl$(i/3t8Af@InBSaCTbCU_CU_CU_CU_CV]CV]CXZCXZCXZCXZCXZBWYBV[BV[BU\@SZ@SZ@SZARXCTZAUZAUZAT[BU\FT\ES[ES[ES[CT[BSZCT[CT[CR^CR^DS_DS_DS_ET`EU_DT^GU]GU]FT^ES]FT^GU_GU]GU]GU_GU_FV`FV`GX_GX_DX]DX]DY`DY`CY^CY^EX_DW^֫a9;a69_45a15a14_34_33]43]42]11\0-\0,[/,Y-+X,.W*.W*-W'-W'/W&-U$,S$,S$.R'-Q&*Q"*Q")Q )Q +P!+P!/O#/O#.N".N"+N+N'N&M&M&M)M!(L ,K!-L",K!,K!,K!,K!+J *I*I)H)I)I)I)I'J'J$H"F!E D D DCC!B!B#B#B%A%A$B$B CB!A @#=#=%>%> ? ? @!A"B#C#@"?!?!?&?'@'@'@)?)?'?'?#@#@"?"?!>!>"?"? >!?!> "?!!>!!>!#=!"< <"!=#=#=#<&<&!;&"<'"<(#=)!?+!?+#>-$?.(>/*@1-B6/D80E91F:2-BE/ehR{¯¯¯¯¯­~~~}}{zyxxxvuutqroonmmmmlnm~n~n~l~j|h{fyRfJ^EiEBfBAeA>b> @ @ @"B"A"A"?"?#>#>$@$@'@'@%>&?&='>%>$=!>!>!>!>!>"???>!>!!>!!>!"< :!;"< !>!!>!!<$!<$#;&#;&!;'!;' >* >* ;*"=,'=.)?0,?3/B60C71D85G7+=- '+2edSu~~~~~°ðñį¬~~|{xwutttttssqqqpppnnnllll~l~l~l~gybtL\EU8E4A+<'8%4$3'-%+!'%"!                                                                         ~ ~ } }{{{{zzyywvwwvvxxv t s s p o m mmmlmmm knkkkjh"n00i<<!?"@%B%B!@"A!?!?"?!> = =!?!? @> = =!>"?"?!>??>>>>??>!= = < : : ;!<"< #=!#=#"<"#;&#;&;';'<(<("<("<(%<+'>-,<1-=2-@4/B6/C9/C9,>.,2:#YaJ{~ny|}|||}|}~~³¯¯®~~{|yxwvvvtttsrqsqsrssrqoomllodr[iPWGN;D8A+<(9%4#2 ,*'%"                                                                          ~ ~}}{{{zyyyxvvvvwvvvvu q q n n n m m m l ml kl k i jkjil)*g67tMUqGOkEU_EU_DT^CS]EV]EV]BT^AS]BT_CU`CV]BU\BU\BU\BU\AT[@SZ?RYBR\BR\BR\BR\CS]DT^FT^ES]CS]CS]AS]AS]AT[AT[AUZAUZBU\CV]@U^@U^@T_@T_@U^@U^@U\@U\AV]AV]AW\AW\HV^IW_IWaIWaIWaIWaCXaCXaBW`BW`CX_CX_EY^FZ_ܬtf>Q0(K0SAk5Gq;Bj??g?d<=a;<`:9`99`96`76`75`43^26\15[09Z08Y/7Y-7Y-5Y-5Y-2Y*2Y*1X)0W(/V)/V)1U)/S'-Q%-Q%*P%*P%*P%*P%*Q$*Q$*Q$)P#)O$)O$)O$(N#*N")M!+L"*K!*L *L *K!*K!(L!(L!(M'L&M&M(K)L$K#J#J"I#L#L#I"H#F$G#E$F!D!DDCDCBB!B!B#A#A#@#@"@!? ? ?!>"?#B#B!@!@ = =">#?#>"="=#>"?!> = = ="??>@@>>=>?@??!;!;";!:!:";!<"=#=!"< #;&":%;%;%!<$!<$#;&#;&'9)'9)*9*,;,-?/.@0,C2/F53G7-A1"-6A2]`Puxh~{{{|}}{|zz~ð||{{zzwwtttststsrrttttppmmkjh~f|XiN_CP>K4B1?*9%4".+('#"!                                                              ~ ~ ~}}{{{zzzyyxyyxvvvvvut s n m m mllllikii hifhgj& e/)nABjHIqGT`GT`CU_BT^BT^BT^BT^BT^BT^BT^BV[BV[AUZBV[DU[CTZAS]@R\@SZ@SZ@R\AS]BT_BT_BU\AT[AT[AT[AT[BU\AUZAUZAUZAUZ@V[@V[?T[?T[@U^@U^@U^@U^@U\AV]AV]AV]CU_CU_HV`IWaKW_LX`HWcHWcCWbCWbBVaBVaBW^DY`BZ`BZ`زt}l9W0$B.\.=k=?l@>k??f?>e>"> >!???>>>?@?@???? @???> :9#9#9#8#8#:!#:!"<""<"";#!:":":"9$ :%"9&!8%$7)#6($7+%8,&;/(=1'>2*A5-D8.E95E;-=3;D3NWFqwf|q}|vvvvwxwxz{|}||{z{{}~~~Ų~~}}}~~}||{{{zzzyvvttssrqrrssrrsrrro~n}ey`tRcIZ@N;I4B/=,7(3#+!)%"!"                                                             ~ ~ } }}}{{zzyyyxxyyxvvvvut q q m mmmlll kjj i i ij hjgheh/5i@FzEScEScEV]EV]CW\CW\CW\BV[BU\BU\CW\BV[BWYBWYBWYAVXAUZAUZAUZAUZFT\FT\CU_BT^?T[?T[@V[@V[@V[@V[?T[?T[AUZAUZBV[BV[@V[@V[@U\AV]AV]AV]AW\AW\AV]BW^AV]AV]FW^GX_JX`JX`JXbJXbFXbEWaBW^BW^AZ^B[_C[aC[aٸpIX5 D0T(7f<>mCBiB?f?Ac=@b<=`8=`8:`5:`5:`5:`5:`5;a6:`57]27Z26Y15Y.4X-4X,4X,6X,6X,4X,4X,3W+3W+2V*0T(/S'.R&0R&0R&.Q)-P(-Q&,P%+P!+P!-P!-P!-O#-O#-N$,M#.N".N".M#-L",M#+L")N'L'L'L)L(K*K*K*K+L)I(H%I%I"K!J"H!G%E%E%E$D"E!D!D!D!D C D D#C#C#B"A"?!>"A!@!A @ @??? @?<< <!== > = =!>!> =<< ===?? ? ?!?"@!>!>!= <99!8!8#8#8$:#9":": : 98 9!!7""8#$7$#6##4&&4)'5*'7,)9.'<0)>2+?5.B8/C;,@8/?-0@.V_Elu[uxoz}tt}{t}{r{~r{~r{s|t}t}t}u~wxwwyz{{|}z{|~~~~~}|{{{{{{zywvttsrrpppqqrqpponml~et[jMYGS;L6G1A-=)5%1!* )#"!                                                       ~ ~ ~ ~}}{{{zyyxyyyyxvvvvut q q p o m mmml k k k k kkkikfgee(+j9<{BMfCNgDU\DU\FU[FU[ETZETZCT[EV]CV]CV]BWYCXZAXZ@WY?UZ?UZAUZAUZGU]GU]EV]EV]BT^AS]@U^@U^?T[?T[?T[?T[AUZBV[BV[CW\AT[BU\@U\AV]AW\AW\AW\AW\AV]BW^BW^BW^FW]GX^IX^JY_JX`JX`HY`HY`CY^CY^DZ_DZ_EZcEZcŴ~Vf6-= /N$Ji?HjDGiCEe?Cc=Aa;?_9=`8;^6;_4;_4:_0:_0:`/;a0=`1:].9[/7Y-6X,6X,6X,5W+7W+7W+7W)7W)7W)6V(5U)4T(3Q*2P)1P&1P&1P&1P&0O%/N$-O#-O#-P ,O/O!/O!/N$.M#0M"0M"0L#0L#-L"-L"(M(M(M'L)L)L*L*L+J,K+J+J(J'I"I"I%F%F%E%E%D%D$D$D#C#C#C!A C C C C#A"@#=#=#=#=#@"????>>=!:!:!:#<!="> = =!>!> =<;;;; :!;#<$=$=%>";";";";!9!9 8!9#8#8#9#9#9#9!8!8!7 !7 "5"#6#$4"$4"%2#%2#&3$(5&'5*)7,)9.+;0+>0,?1-@40C77E3.<*<`:;_98`77_67_46^38_07^/<_0<_0=]/;[-9Y-8X,4X,4X,3W+2V*/V)0W*/V'/V'1V'1V'/R*.Q)/O(/O(1P&0O%1P&1P&.O%-N$-O#-O#+Q +Q +P!+P!-N$+L"-M!-M!.M#-L"*K!*K!*L *L *M)L)L(K*L)K+J+J(H(H&I%H%I$H&H%G&F%E%E$D$D$D#C#C BA C C!B!B"?"? = =$<#;%<%<#>"=!:!:!:!:!:!:!:#<!<"="<"<"<#=#;":";!:#8$9$9$9$9%:#;$<::::#9"8"8#9#8#8"7"7"7"7 7!8"8!!7 !6#4!!4!!4! 3 !4!4!4!5(8+!8-!8-%91(<4+<5,=6-A9/C;/=28F;T]L`iXionjpohquhquhquirvjryjrylt{lt{lv}mw~mz~n{p{q|r|r|t~vtvwwy{~~~~||{{{{zyxxxwwvvvuqpppqqrrrqn}fu\fQ[GNDK;E6@/:-8%3"0+(#                                                                   ~ ~~~}}{{zzzzyyyxxxvvutttr p m mmmlll k k k ijfghgggb#l3GmBEk@Bf@@d>>b>=a=9_;8^:7_66^59`39`3:^29]1<\.;[-;]*:\)6Y)5X(3Y(2X'3X)1V'1V'1V'2V#2V#2T(1S'0Q'/P&1P&0O%0P$0P$/Q%.P$,P%+O$+O#+O#+R*Q-P -P ,N"+M!,L -M!-M!,L )L)L(K)L)L*M*M)L)J)J*I*I(H(H'G&F&I%H%G%G!G!G!G F#C#C#C"B"A!@!@#B"@"@"? =!: 9":#;%;%;$;#:#9#9#8#8!:!: :!;"<!;!;!;#;#;";!:#:#:!:";#:#:"9"9":": 9 9 8!9 8 8"8"8"8!7#5#5!6"7#7 #7 #6"#6""5!!4 4!4!4!3 3 4!4#6% 6'"8)'7,)9.+;0-=2,?3.A52@5,:/?Ic;FkCFkCBg?@d@?c?=`>;^<;_;9]98^37]29]19]18].8].9\,8[+6])4['1Y(0X'/X$/X$/W&/W&0V%/U$1T%1T%1R(0Q'/Q%.P$-O#-O#-O#-O#,P%+O$+O$+O$+O$+O$-O#,N"-P!,O .N ,L,L -M!+J *I*J)I(L(L(L)M+K*J+J+J+I+I(G'F'G&F'F&E$D$D$D$D$D#C%C%C&A%@">">!?"@!> =!:!:!7!7#8$9$9$9#9#9#9#9!9!999<<<<99!8#:!:!:#9#9":": : :!8!8!8!88888 8 8"8!7#6"5 5 566 6!5 "5!#6"!5!5!4!!4!3 22!3"4$4$4(5)"7+#8,%:.'<0)?0*@1,A5.C75C8?MBO[PZf[^gc`ie`gjahkbilbilbhmcinalpbmqbnpdprhsqjusmtwnuxmvyox{py|r{~s|t}vxxy{}~~~~~~}|zyyyvvutttqqqqrrqppprrutq}q}jv[gNYHSBK@I8D2>,9'4"/,&#                                                                ~ ~ ~ ~ ~ { {{{zzyxxxxxvvvuttr q p p p o o ooomm i iii hiiiff $_59t?IeAKgDS_DS_DU\DU\FT\FT\FT\ES[DU\DU\EV]DU\DS_CR^ER^FS_GU_GU_FT\GU]DT^DT^BT^CU_@U\@U\EU_DT^FS_GT`GT`FS_FS_FS_EU_EU_EU_EU_ET`ET`EU_EU_EU_EU_CU_CU_CU_CU_GU_HV`HV^HV^JX`JX`IZaHY`HXbIYcկitMDO(%DCb0EkGDjFCgCAeA?b@=`>:_=9^<8_87^78_28_29^/8].:].9\-9\,8[+7[(6Z'3Z&2Y%0Y%/X$/X$/X$2U%2U%3S%3S%3S%2R$1R"0Q!/P /P /O#/O#-O#-O#+O#+O#+O$+O$*M%)L$)M!)M!+N*M*M*M+K*J+J+J+K,L*L+M*J)I)I)I)J)J)H(G*F)E)F(E%E$D#B#B#B#B&A&A&B%A$>$>#>#>";!:#9"8!7!7":!9":":!9!9!9!9#9#9!9": 9 9 : : 98!8!8&9%8&9&9 : :;;::!7!77788 7 7!7!7#7"6 6!7!5!5"5!"5!!4 !4 #4 #4 #3!#3!!4!!4!4#4#2&2&2( 4*!5+#7-#8,$9-'<0)>2*?3,A51B;1B;BPEKYNUaV[g\WdbXecVcgWdhYcjZdkZdk\fm[hl\im`lnbnpdnudnufpwhryhuyivzmx|mx|p{q|s}t~vwy{|~}­~~~~|||{zywxvvvvttqqqpqprrrqutq|lw^jUaKSHP?J)8%4!.+ #!                                                            ~~~~~{{{{zzy xyywvvvuttt q q p p p o o ommll k kiihjihfd],,r:@g@FmDO`DO`DR\DR\GS[GS[ES[FT\BU\BU\@U\@U\ET`DS_FS_GT`GU]FT\CT[DU\AS]BT^BT^CU_BT^BT^DT^EU_GU_FT^GT`GT`FT\FT\EV]EV]DS_ET`ET`ET`ET`ET`ET`ET`ET`ET`ET`ET`GU_HV`JV^JV^IX^IX^EWaEWaHXbIYcʸqKV)6ACT+Uf=MjGIfCCdAAb?>b>=a=;_;:^:9_48^3:`/9_.:]-9\,:]-:]-;\,:[+7[(6Z'2Y%2Y%/W&/W&/X$/X$0W#0W#3T$3T$3S%2R$1Q#0P"/O!/O!/O#/O#-P -P +Q +Q +O#)M!)M")M"(M(M)P'N)L*M,L+K*L*L*M*M*L)K)J)J)J)J)I)I+I)G(G'F(G(G%E#C#C#C%C$B$B$B&B&B#@!>">">#<";"9"9 98 : :!9!9#9#9#:#:#9#9#9#9$9$9":":"8"8#8#8'8(9(8(8"8"899!9!9 8 8888877#7#7#7#7!7 6!6!6!5!5#5#5%4 %4 %4 %4 !3#!3#!2$!2$2$2$2& 3'"5)#6*%5*'7,*9*,;,-<-/>/1?45C8:G>BOFIVMP]TQ^\R_]T]`V_b\^b\^b]`a]`a^ab`cdadecfgehigjkcmmdnncpoerqkrumtwnuxpwzrzzt||p}|suvyz}~}||~}||zyxxwwtttuttrqppqqrqtttr}pzhrVaQ\HRDN;H8E/@+<%6"3 +&!                                                                  ~ ~{{{{zzyyyyyyvvuutttt q q p o m mmm k kkkiifhfedc^%"k8:f@BnCMZDN[GQXHRYFSYGTZES[ES[AS]AS]AT[BU\DT^DT^GT`GT`GT`GT`BT_AS^BT_BT_BT_BT_CS]CS]FT\FT\FT\FT\FT\FT\FU[GV\FU[FU[DT^DT^CU_BT^BT^BT^CU_CU_EU_EU_EV]EV]GU_GU_GU]HV^HW]HW]FW^HY`HXbHXbǿKV6/MA_#Lm=Kl!>#<#<%:$9":":":!9!9!9!:!:#:#:!:!:;;";";":#;$9#8#8#8%8%8%8&9!9":!9!9!: 9 8 8887799 7 7!7!7#6#6#5#5#5#5#5#5"4#5#4 #4 !4!!4!!3#!3#!3#!3#2$2$2&!4(!3)"4*$7+%8,$9-&;/)=5+?74C<7F?BJDJRLPWSSZVOX[OX[PY]PY]QZ^PY]R[_S\`U^bW`dZcfZcf[hg\ihYil[kn_lpbosipskrumsxouzpy}qz~r{s|vxvxy|}~~~}~~~}|||{zzyyyxxyxxvvutsrqqp~qq~p}jubmOZMX?N)9%4 /(%!                                                                      ~ ~ } } { {{{zzyyyywvvvttttr q q q p o m ml k k k k kiihhcccc``+/c8

L[@N]ARXARXBTWCUXCTZCTZBR\BR\BR\CS]ES]ES]ES]FT^FT^FT^DT^CS]CS]DT^DT^DT^DU\CT[BV[BV[AUZAUZBU\BU\?T[@U\BV[BV[DU\DU\BU\BU\@U\@U\@U^AV_EU_EU_GU_GU_GT`GT`GU]HV^HV^HV^IW_JX`JX`IW_ϕfwE7H5X#Kn9HlFDhBAe??c==b: ="<"<"<#=#:#:#9#9!:!:;;=<==";!:!:!:!9!9#:#:"9"9"8#9;;;;:97 8 8 8::997 8"7"7"6#7!7!7776666 4 4!4!!4! 1# 1# 1# 1#2"2"1%2&1' 2("5)#6*#8,$9-'<0)>2.A51D89G<>LAIQKNVPNSTNSTLSVMTWMSXMSXNUXOVYQX[SZ]U\_W^aU`dWbfXcgZei^gk`imelognqhorjqtjsvluxmvzpy}r{t}sttvy{}}°­~~}}||~|{{{{zzzyyxxxxxxwvuutp}p}p}p}n}l{brYiHXEU:M8K2D.@-:(5%/!+$#!                                                                         ~ ~ ~ ~ } }}}{zzzyyxxxxvvttr q q q p o m mlll k i iiiiihgddddbc"&a15p9I`SZ>SZBSYBSYETZFU[CW\CW\AXZ@WYAV]AV]CV]CV]EU_EU_EV]EV]EV\FW]FW]FW]GX^GX^FY`FY`ۻgmNMd "= = = < < <;"="=#;#;#:#:!:!:<=>> < <!:!:#9#9#9#9#;":!8!8 9!:; <::987777!9!9 8766!6!6"6#7!7!766665554220"0"/!/!0 1!1#1#1#2$ 4$!5%#6(%8*&9-)<0-=2/?47C8:F;DKAGNDMOJNPKNNNOOONNONNOOOOPPPQQQSSSVVVWWWTYZUZ[R_^VcbXdfXdfZfh^jl_kmamoenqgpskrunuxqvwsxyuz{v{|r}trsuwz|~~~}|{{{xwwwwvxxxxxwuttton~n~n~k{iy\mPaBRAQ;K9I5C2@.9)4$- )%#                                                                  ~ ~ } }}}}}{{{zzzyyyxxxvvvuttr q o ommm l k k k kiiiihheedeab\-.k@Ge@GeAOWCQYDTWEUXEUXDTWDSYDSYDSYDSYBSYBSY@TY@TY@TY@TYDU\DU\DT^DT^CS]CS]BSZBSZAT[@SZ?T]@U^@T_@T_AS]?Q[AQ[BR\DU\DU\CXZCXZAW\AW\@U^@U^EU_EU_ET`ET`EU_EU_CV]CV]CV]CV]HV`HV`EWaEWa߼qCQ(9X!Dc,@e6Fk#<";";!:=<== > >#;#;"9#:!:!:;;;;":!9!9 889;; : :88;<<<::99887 8#8#8"7"7!5!5!5"6 6 6 6!7 4 4345554110!0!/"/"/"/"0#0#1"1"2& 3'2(!5+#7/%91$:2&<4%=6)A:-D@1HD7HG9JI?HL?HL?GN@HOAJNAJNBKODMQFMVGNWEOWHRZIV\LY_O\bO\bT]hW`kYck[emZjm]mp_oraqtdqufswhvxjxzhx{l|n~prtuwy|~|||{zzzyvvssrrvvwxxwvuutqqn~n~n{iv^hS]IPFM=G;E9B4=28-3(-&+$!                                                               ~ ~ ~ ~}}{{{{{zzzyyxxwvvvvutt q q o ooom l k kiiiiiihggge d c c]"g:Bk:Bk=OZ>P[?RY@SZDRZCQYGQYHRZHRYHRYDSYDSYDSYDSYBSZBSZCS]DT^CR^CR^CR^BQ]DRZES[CT[CT[?T]?T]@T_@T_CR^CR^DQ]ER^CS]DT^BU\BU\BU\BU\BT_BT_AU`AU`CU`CU`ET`ET`GT`FS_FS_GT`ET`ET`DV`DV`ő]o9"="> <<<;;<=>>!=!= : :!; :!;!;!:!:!9!97888!9 8!: 99:;;::::999:89#8#8"6"6!4!4!4!444 5 545424555221!1!0 0 .!/"0!0!/!0"1#1#!1(#5+$6,%6/&70(92+<51A63C88D>9E?>CD?DE?DG?DG?DE?DEAFIBGJEGKGIMFKNHMPIQQLTTNVVOWWTY\W\_Y^a\adZcf^gj_hkajmdmpforgpsjsvjuylw{nz|p|~q}txz{|}||||{{zyvvtsttxxwwwwttrsq~q~n}n}l{etU_OYDM@I8F5C6@2P[@R]DQ]DQ]FQ\FQ\GS[EQYDSYDSYCRXDSYDRZDRZBQ]CR^AS^AS^AS]AS]AT[AT[BU\AT[AS]AS]BT_BT_CR^BQ]ES]ES]CS]DT^DT^DT^ET`ET`AR`AR`@T_AU`ET`ET`ET`ET`GT`FS_ET`ET`CU`CU`CU`CU`⫯tx_GW!EUPk8Sn;JiFFeBDc@Cb?>b7=a6;b5;b5:a48_2:^29]18].7\-5^*4])6[&5Z%5Y&5Y&5Y&4X%3W$2V#/U$/U$/U$/U$/V"/V"0T!/S 0U /T0T!/S 0Q!/P 1P 0O/O/O-O-O*O )N'M"&L!&M 'N!*N)M*L)K)K)K)K)K)K)K)K)K(J(J(J'I&F%E$E$E!D"E D D!D C#E#E#E#E#C"B"@!?"=!<!=">==<<<<==<<;;!: 9 9 9#:#:#8"77 88898;;9999::::988:79#8"7$6"4!5"6"5"5 5 556665333432111/../001 2!1#1#!1&!1&!3)"4*"2-#3.%50'72-<5/>72?=3@>5>A5>A7>A7>A8>C9?D;AF;AF;DHK6G3D2=/:.5+2#- *$                                                     ~ ~~~~~{{{zyywvvvvvvvt s q q q q o omml k k kiiiiiiiighedb a\`-,a54iP[CP\CP\GR]GR]DRZDRZDRZCQYBSZARY@QXARY@R\AS]?S^?S^?T]@U^BT^BT^AS]BT^CR^CR^CR^CR^FT^ES]ES]ES]FT^FT^FT\GU]GT`FS_DS_CR^BT^CU_GU]GU]GU_GU_EU_EU_CU_CU_CU_CU_CU_CU_}a]hADU#Vg5SrBOn>DhDAeA@d>>b<;`8;`8;a69_4:_0:_09^/9^/9\,9\,8\)7[(6Z'5Y&3Z&2Y%2Y%1X$3W$3W$4V#3U"1U"1U"2V#2V#1U"0T!0U 0U /T/T-Q-Q/Q.P.Q.Q.P/Q,M#,M#,M#+L"*M*M*M)L)L)L+K+K+K+K)L)L)K(J'H(I'H&G%G$F#E$F"F#G!D!D#D"C$C%D%D%D"B!A">!=#<";#<#<=<;<; <">">!=;!;!;!: 9 : :88888 98889::::::::::9899788755!5"6"5"5 6 6 6 6 6 65444432110/...//1 1 /!0"/$ 0%!1'"2(!/*#1,$2-'50)72,:5.<70>91;;1;;1:=2;>3==5??4@B4@B5@D9DH:EI;FJSZ?T[@U\@U\@U\?T]@U^@U\@U\AS]AS]AS^AS^BT^AS]CS]CS]DT^DT^DU\DU\DS_CR^ER^ER^ES[FT\GV\GV\EV]EV]CU_CU_AV_AV_BW`AV_AV]AV][a.TZ'H_$Sj/HnCFlA@g@?f?=e<;c:;_99]7:a48_29_.9_.8^-7],5\-5\-5\-4[,2['1Z&0Z$0Z$1X#1X#5W$4V#3U"3U"3U"3U"1U"0T!1U".R/U.T/S /S .Q!-P -P -P ,O-P ,O,O,O +N+N+N*M*M)L(K)K)K)L)L)L)L)K)K(J'I'I'I'I&H$E$E"F"F GFFF!C!C$A$A$C$C#B"A!=!=!:";";#<"> <;; <!=#=#=#>"=!:!:#:"9#:!888999:9877999999::::998778774455"6!55565 65452311110/.-,,+--",!. . . /!"1##2$!1&!1&"1*$3,'6/)81.;2.;2.:5.:50951:61;53=74=;5><5>A6?B8AE:CG;DGHUAKXAOYAOYBPXBPXCQ[CQ[BQWCRX@TY@TY>TY=SX=SX>TY@TYAUZAS]AS]BT_BT_BV[BV[?UZ?UZ?T[@U\@U^@U^DT^CS]DT^DT^ES[ES[CS]CS]AS]AS]AS]BT^ET`ET`ET`ET`ET`ET`CV]DW^BW^AV]AW\AW\ଶ{g2OC`!Im:Koe>2>@1>B2?C2BE3CF7DH8EIIM@KOBMQ@PSBRUDTWGWZMX\OZ^S[bV^eUbhXekZgm\ioakrdnufpwiszjuyny}p{q|stvy|}~~}zzzzyzzyyyxxxwwvttutsssrprhyctUcN\FQBMR]>R]@T_@T_CU`CU`CU_CU_AV]AV]AV]AV]AV]AV]Ën`lC4RMk/LoGJmEFiGBeCAeA>b>=b:;`8:`59_46a/6a/5`.4_-3\/3\/3]-2\,2])1\(2['2['1[%0Z$1X#0W"0W"0W"1V!1V!0T!0T!/R"/R"1S 1S 0R/Q0P"1Q#0P$/O#-P!-P!-Q-Q.Q-P/O/O,O,O,N+M+M,N*L+M.N,L,L+K+J+J*I*I(J'I'I'I&G'H)H'F%D%D%D%D'C'C'C&B"D!C!B A>=";";";";$;%<$;$;#<";"<"<"=!<#;#;#;#;!;!;:99:99 98!8!8!8!8!:!:989::98766557654455665554445200/./00/.--..--,,,--# 0�'#0'".(#/)%1+'3-'6/)81';3&:2&93%82'74)96/:8/:80::2<<1=?3?A1?A4BD5CE7EG7EG:HJS\@U^AU`AU`AV_AV_CV]CV]CV]CV]CU_CU_CU_CU_ԬmxIGR#9WUs7NoLIjGCgCAeA@e=?d<=b:;`8:a48_25`.5`.1^,1^,1^,1^,0^)/](1\(1\(2['2['1Z&1Z&2Y$1X#1X#0W".U!.U!-T -T .R/S 1S 1S 0Q!0Q!0Q!0Q!/O!/O!/O!/O!/Q/Q0O0O0O0O-O-O-O,N-L-L.N/O,N+M,K+J,I-J,I,I*I)H'H'H'G(H(F&D&D&D&D&D%D%D%D$C!B!B!B!B!= <";!:#:$;$;$;$<$<$<#;#:#:#;#;#:#:#;#;#;#;88::88"9!8!8!8"8"8"7"77 88999 985 6 5!6"5!4 3233454334 3 3 2 21000////...--,+,+,+, ,".!#/$$0%$0%$0%%0'(3*(5,*7.*:0*:0'81'81&61'72,75-861:81:81<:2=;2?=3@>5B@6CA8EC:GEKI?KM@LNAMODPRGQQJTTLUXNWZLZ\P^`T`bVbd\cf_fi^jl`ln_pqarsduvgxymx|p{s|vvxy{}~~zzzzzz||{zyxwwuttsssqqoolj}du\mP_JYAM?K>H=G8C4?+7'3$*"(%"                                                     ~ ~ ~ ~}}{zzzzzzzyxvvvvttr q p o m mlll k k k k k k kiiiiiiggcc]]]]^`)(]0/d9@Q=DU?JNALPCNRDOSAPVAPVBRUBRUBRUCSVCSVCSVDTWDTWDSYDSYES[ES[ES[ES[ES[ES[DR\ES]FRaEQ`AR`AR`BT_BT_ES]ES]ETZETZDVYDVYBU\BU\@T_@T_AU`AU`AU`AU`CU_CU_EV]EV]CV]CV]AV_AV_溾qMe.@X!Gk2Pt;JkIGhFBfB@d@?c=>b<=a;;_9<`4:^29_.8^-5^*5^*1_*1_*/](/](3\(2['6Z'6Z'7Y&6X%3X#3X#2V#2V#1U"/S 1S 1S /Q0R0Q!1R"0Q!0Q!.R-Q/P /P /O#/O#/P /P /Q.P.P.P0O/N0L0L/L0M,O,O,N*L+J+J,I+H,J+I+H,I'H'H'G'G(E&C(C(C$D$D#C#C$@#?&@%?%?$>#<";";!:;; < <"="="=!<#:#:#9#9!:!:!;!;!;!;;::97788"9!8"8!7#6$7"7"7999976 5 5!6"7!5 4 5433222222 3 3442101//---,,+))((*+*+,!-".#.# 0% 0%2& 3'!5-#7/$71$71$63#52%43%43*36+47.49/5:/8;/8;-;=0>@/@A0AB4BD6DF7DH8EI8HK:JM;KN=MP@PSAQTCRXETZGV\IX^KZ`M\bQ_gTbjQdkUhoTipVkr[nu]pwes{ft|lxnzoqruvwz}~~~~~~}||wvuuutttssrqrqm}l|bqTcMWKU?L*4&0&*!%!                                                         ~ ~}}}}{zzzzzzzyxvvvuttr q p o m mllll k kl k k kiiiihge d c b]]]]\_"\#*d,;T0?X9GOb><`<<`:;_9;`19^/7`,6_+5^*5^*5^*4])3[*3[*7Z*6Y)8Z'7Y&4X%4X%1X$1X$1X$/V"2T!1S 0R0R1P1P1P1P/Q0R/Q/Q/P /P /O!/O!/Q.P/Q/Q/Q.P.O-N/N/N.M.M.M.M.M-L+J+J*I*I)I)I)H)H)G)G)F)F)D(C'B)D%D$C#B#B$@$@$@$@$@">#<#<<:<<= >"="=!:!:#9#9#9"8#;#;#;#;!<:::9978 87!7"8!6"7#6#6#8$9 9!:88 5 5!4!4!4"5 5!643233344 5423333300//..--,++*))*+,-,--. 0" 1#!2$!2$$4)&6+%7-&8.$80#7/#52#52)25)25-47.58/6907:-:9.;:1=?2>@3?A4@B6BD8DF;EE=GG>HH@JJAJMDMPCNREPTHSWJUYKVZNY]R[_U^bU`dXcgXeiZgk\im_lpdoshswluxox{r{~s|vyyzz|}~~~~}}}|wvuusrrrrqrrrqm|jyXiEVEODN>K=J:H7E1?+9%2#0)'!                                            ~ } } } }}}{zyyyyyyvvvvvuttttr p l klllll k k kkkihghhhgg d c`___\_!X%(_/7Q5=W;FJ>IM@MLANM@QPARQARSBSTBSTCTUDTWEUXES[DRZCQYES[EUXFVYCT[BSZBSZBSZAS]AS]?S^?S^?S^@T_BT^AS]DU\DU\DU[CTZDU[DU[DU\EV]EU_EU_CU`CU`CU`CU`CU`CU`EV]EV]EV]EV]EWaDV`ᰴ~aIX,Ac"Qs2Nr?Lp=EiEBfBAeA?c?=b:;`89a68`57b05`.9`+7^)9]*9]*7^*6])5\(5\(7Z*7Z*7Y&6X%3W$3W$1X$1X$2V#1U"2T!1S 1S 0R0R/Q/R0S0R0R/P /P /O!/O!1P 1P 1P1P/Q/Q-R,Q.P-O-N-N+L,M,N,N-L-L.J-I*I)H)H(G(G)H+F+F+F*E)D(C(D(D&C%B%B%B#C"B"A!@#>"=$=$=">!=><=="=!<#:#:#9#9#9"8#;#;!;!;:999998888!7"8!6!6!7!7!8!8"9!8 5 5 5444!4"5 5 565444555 544433210010//..++,,)))*++,,+-/!/!1"3$!4(#6*"6.#7/#52#52#52"41(14(14)25*36+47,58+79-9;,:<-;=2=A3>B4?C6AE9FE9FE:GFKJ?LK>OP@QR>QR?RSARSCTUDSYDSYES[DRZDTWDTWDTWEUXDSYDSYCT[BSZ?T[?T[@U^?T]AS^AS^DS_ET`EU_EU_DU\CT[DT^DT^DU\DU\DT^EU_EU_EU_EU_EU_EU_FV`DV`DV`DV`DV`EWaDV`ώj}DDWKm-Xz:OoHKkDDhDBfB@d>>b<$>#>#>!=!=#;#;#:#:#9#9#:"9":#;!;!;::9999 9 9888876669977666655444 565435544444432211000//.-,+******)**++, , -!."1%2( 4*"5/"5/$41%52%43#21%13%13)25)25(37(37%58(8;)9<*:=+:@-S=R;L7H8C4?08-5)2)2%-#+ %!                                                          ~ ~ } }}}}}{{{zyyxyvvvvvvttttr q p o l lllllll k kiiggggggf d c b``__]\V!\*/T/4Y3@L5BN6IJ8KL7LM9NO:OQ;PR=RT>SUARYBSZES[DRZCTUCTUCTUDUVDTWCSVCRXDSYAT[AT[CV]BU\BT^BT^DS_DS_ET`ET`EU_DT^DT^DT^FT^FT^FS_GT`GU_GU_CU_CU_DV`EWaEWaDV`FW^FW^FW^GX_۾ǭveRm3>YLo?SvFHkIFiGCgCAeA@e=>c;B3?A6BD9CC;EE9FE;HG;JI=LK?MOAOQBOSDQUFSWIVZHX[K[^M]`O_bRbeTdgZei^im`lncoqcqsftvgxyiz{l}~l}~q}svx|~~}||||{zzywwuutttttsrq~oyeoQaJZK9AN7DH9FJ>JL?KMAMOCOQ@PSAQTBPXCQYES[ES[ES[DRZCSVCSVDSYCRXCRXDSYDSYETZFT\FT\ETZETZFT\FT\GU_GU_EU_DT^EU_DT^FS_GT`GT`FS_GT`FS_CU`CU`BW^CX_FW^GX_GX_GX_IW_JX`Φ[fFC`!Pm.OrCOrCGkGEiECgCAeA?e:=c8;b3;b3:b19a07`,7`,6_+6_+9]*8\)9Z*8Y)7Y&7Y&6[&4Y$0Z$/Y#/X$/X$.W#-V",U!,U!-T ,S,S,S+R+R/Q0R3P3P3P2O1P1P1P 0O1P1P/Q.P-O-O-M-M-L",K!+K,L+L+L*L*L)K(J+H+H+H+H+G+G*E*E&C&C$E$E$D$D%E#C#C#C$A#@">">$=$=#<";$;$;#9#9$7$7$7%8#9#9!:!:!: 9 9!:!;!; : :999: 9 9"8"8"7"7"7 5779877566677554544442233444422211000./-,+*))()))('()*+*++!.$/%1'!0)#2+$1/%20%21%21"10"10"02#13$24$24#45%67&78(9:)9<*:=+:@,;A.>A/?B2@B4BD4EF5FG7HI:KL9KN:LOPS@QXBSZBU\DW^G[`I]bK_dNbgRcjUfmWhnYjp]mp`pscsvfvygwziy|k{~l|n~ruz}}~~~}}}|{{zxxvvvvsrq}p|nwbkOYLVENBK>G;D6@2<)8%4$.!+"$!                                                                 ~ ~ } }}}}}}}{zyyvvvvvvvvutttt s q p m mmmmml kl k i iiigggge d a ``_]\]\V[#*U)0[,N3AI5CK9FJ?e:=c8.;?0=A3>B4?C6AE8CG:FHNQ@OUAPVBSYEV\GY\I[^K]`N`cScfUehWflZioYkn\nq^ps`rueuxfvyiy|k{~l|n~qvz~~}|}}||{{zyyywvuttsr~r~o~l{esWeJVIUDN@J>G:C1?-;(6$2"* ( %!                                                           ~ ~ } }}}{{{{z y v vvvvvvvvuuuttr q m mmmmmll k k k kkkiihg d d a `____]]Y]"&T(,Z/9N0:O1?I4BL7DH:GKKOANTCPVAOWBPXBO[CP\DQ]CP\CP\DQ]CQ[CQ[AQ[AQ[BQ]BQ]ER^ER^DQ]DQ]DR\DR\FT^FT^FS_GT`FS_GT`GT`GT`GT`GT`GT`GT`GT`GT`ET`FUaFUaFUaFUaFUaFUaGVb̘Vh+?QIk2XzAHsNDoJAlG?jEAg<@f;>e8$>">">">!=;;<< ;:!9!9::::88 8 8!:!: 9888 9 976 6 6!7!7"8"8 5!6 54545587544455554244552222102110.,++++**)))())(('()))** +!*%+&!-'#/)#/)%1+$3,$3,"2/!1. 0- 0-$10%21%43%43&46'57(68(68,98-:9.;:0=<4=@5>A7@D9BF9DH9DH;FJIM@KOANRBOSBRUEUXGWZIY\L\_N^aQadTdgUfgXijXklZmnYqqZrr]tv_vxgwzhx{ly}n{p}tz~}|{||{{|{yyyywvtsrrpo~h}f{[pMbDX@TAN?L=E9A1<.9&3#0 +)"                            ##                         ~ ~ ~ ~ ~ ~ ~ ~}}{{{{{{{zyyyyxxvvvvttr q q q p o m nmmlll k k kkkiihggg d c _ ___ \ \Y\! U*)^18N18N/=E2@H4DG5EH>GJAJMDMPENQBOSCPTAOWCQYCQYDRZDRZCQYCQ[CQ[CQYCQYCQ[DR\ER^ER^DQ]DQ]ES]ES]FT\ES[FT^FT^FS_FS_GT`GT`GU_GU_GU]GU]EV]EV]DV`DV`CX_CX_BW^BW^DV`DV`~nATBUMn7Uv?JpLFlHGkECgACf>Ad&>'?$>%?">!="> <!=!=";";!9":":!9!9!9 8!9!: 9":":":":!8"9"8!7 5455!8!8"9!876553334 6 633444 5 54"2!1!2"3"3"31010..0110.,****))''(()(''''&''('!)#)$*%,%.'0) 1*!1,"2-$1/#0.$..$..$10$10#13$24%35&46'57(68)87*98-9;/;=1<@2=A3=D5?F4AG6CI7DJ9FL9HN;JP=MP?ORAQTCSVETZGV\IX^L[aN]cQ`fQcfSehRikTkmWnpYprZpu]sxat{bu|dw~fyj{m~rx~~~||{zywvtssrttr~q}k}gyZkPaDUBS@M=J>c;=d5;b3:c/8a-6_+5^*5^*5^*7^*6])9\%8[$7Z#6Y"4Z"4Z"4Y$4Y$4Y$3X#1Y!0X .X"-W!.U!-T .R-Q.R.R+P!+P!+P!,Q",R!,R!/Q/Q.Q.Q.Q.Q/Q.P/M/M.K .K /I /I /I .H-I-I.I/J-J/L,I+H+G+G*F*F)G(F*F*F)D*E)D)D'C'C$B#A$A$A$A#@%@$?#?#?">"> <"> ? ?=< < < ;:!9!9 9!: 9 9#;":!9!9!8"9"7!6 5 544 7!8!8 777664345664334 5!6!5!5"3!2!2!2"2"21011101221-+***+****((''''&&%&&'&(!* * + .# 0%!1&!3)"4*"2/!1.#0/"/.#/1#/1&/2&/2(14)25)33+55-69-69/8<09=1:=3A7@D9BF9DH:EIIM?JNALPCNREPTGRVJUYKVZNY]O\`P]aQbcTefVghXij[lm^op`psaqtcqyes{fvyhx{jz}k{~n~uz~~{{zyxxwvuuvvvus}r|k|duTfPbBY>UHP>KQ?LR@PSBRUCSVCSVCSVCSVDQWDQWDPXEQYDRZCQYEP[FQ\GTZGTZEUXEUXES[ES[CR^CR^CR^DS_FS_GT`FS_GT`GT`GT`EU_EU_EU_EU_GT`GT`GT`HUaJU`IT_Ɋn_jCC^,ZuCSuOPrLJnJGkGBhD?eA=e:;c8%>%> ?>>> < <::;;;;!<!<!<!< ;!< 9 9766678!8 7 76654334675444665522 3 3442222110000,+))++*)**)(('&&&&%%&'')**+ ,!/% 0&2( 4* 2/ 2/0//.!.-"/.$-0%.1'03(14)25*36,58,58.7:/8;09<2;>4=@5>A4@B6BD6DF7EG8FH:HJM:I9@4;3816)1&.)&!                    !!                               ~ ~ ~ ~~~ ~ ~ } } } }{{zzzzzzyyvvuttttt q q q q p p o omm k k k kkkkkiiggee c b ` `__ \ [YYU$!],1N05R/=E/=E2BE3CF4CI5DJ6EK9HN=JN>KO?ORAQTAQTAQTAPVBQWBPXBPXCQ[DR\DSYDSYEUXEUXEUXDTWETZETZDS_CR^AS^@R]AS^AS^FS_FS_FS_FS_FS_FS_ET`ET`ET`ET`GU_GU_IS`IS`JTaIS`̵kyIYg7Li7[xFNtPJpLFlHDjFAhA?f?=e::b7;b3;b3=`0<_/;_,:^+;]*:\):](:](7\'5Z%5Z%4Y$2Y%2Y%0Y%/X$.X"/Y#0W"0W"1U"1U"/S .R/R/R/R0S0R0R-P -P -Q-Q-R-R/R/R/Q/Q-M,L.M/N+K*J(H!(H!)I#)I#)G *H!*J*J+K*J,J,J.H-G+H*G'G&F%E%E)E(D(D*F'C'C&B%A%B%B!C B A A"A!@$>#=#<%>!?!? ?= =< < < ; ;<<;;;:;;<<:88866 7 7 7676664334454445565544 5443323322////-+**+*)*++))'&%%$$%%&&'((((#(#+&-(/*!1, 2/ 2/1./,/,/,.-/. 12!23%26%26'26)48+6:-8<-8.;?0=A/@A0AB2CD4EF5EH6FI9HN:IO;JP=LR@OUAPVDSYFU[HW]KZ`M\bO^dR`hTbjUflXioZkq[lr]nt^ou_tv`uwdu{ev|kzo~sx~~}|zyxxwvvuttqpo~n}hzcuXgRaEVCT>M9H9@4;27/4,0(,#&"                           ""$#""                             ~ ~ ~ ~~~~~ ~ ~ } } { {{zzzyyyxyxvvvuvuttr q q q p o m ml k k kkkkkiiiigge d c b ` `__ \ ZZYSZ*0Q-3T/d@>d9;a6=b3=b3;`1:_0;^/:].9]*8\):](:](9[(9[(5Y&4X%1X$1X$/X$/X$.X".X"/V!0W"1U"1U"0T!/S /Q/Q/Q/Q0R0R0R/Q/R/R-S-S+R+R+Q *P+M!+M!+L"*K!)J (I'H'H(H!*J#(J$(J$(J$(J$*K!)J +J +J )G )G )I'G'G&F&F&F)D)D(D(D(D(D&B%A#B#BCBBA"B @#>#>"=$? @ @>>;;!;!;";";<<;;;: 9!:;;988875 656 766544334444444565544 4 432222322/./0/---**))*)((''''&&&&'(''()(*,".$ 0&!1'3+3+1./,/,/,/,/,#0/$10%13&24'35)57*75*75+87-:9/;=1=?.>A/?B0@C2BE4EF5FG8FH;IKF1?G1?G3AI5DJ6EK7GJ9IL=JN?LPCNRDOSCPVCPVBPZCQ[CQ[BPZCRXDSYDTWCSVDPXDPXEP[FQ\ES[DRZAT[@SZAS]AS]CR^DS_FT^GU_EV]EV]CW\DX]CW\CW\CW\CW\CW\CW\DVaDVa寵rH\*Vj8X{KSvFKrKHoHEkGBhDAeA?c?=c8;a6?b3>a2?`0>_/>_/<]-;\,:[+<\(=])<\(:Z&7Z%7Z%4Y$4Y$/Y#.X",X"+W!-W!.X"3U"3U"2T!0R/Q/Q0R0R0R0R/Q/Q/R/R/R/R0Q!/P -P -P -N-N-M!,L )J 'H%H %H 'J"'J"(J$)K%+L"*K!*K!)J *K!)J (I'H'I%G&F&F(F)G*F)E'F&E$D$D#B#B#C#C!C!C C C!B A$@#?#>$?"?#@ @?"<"<!;"<!;"<!:!:;;;:;;:98777!7 6!6!666655544433444444445455422322210/0/0..,-***)((''''&&$$$$%%&&'(*+ +#-%.(0*/,!1.!1./,.--,,.-/!,0"-1$/3%04#36#36&46'57+79-9;,9=-:>*Q8I3D1;-7*2'/%)#'!!                          "$%&'%                          ~ ~ ~ ~ ~ ~~~}}{{{{zzyyvvvvvvuuttttr q o ommll kll k k k k kiiiihge c _ ____ ^ Z Y W WRZ'.S*1V,:I-;J.?F.?F1?G3AI2CI3DJ0FK1GL5IN7KP=LR>MS@OUAPV?OY@PZ@PZ@PZ@QXARYARYARYCQYCQYCQYDRZES[ES[AQ[BR\CR^CR^ER^DQ]FS_FS_BU\BU\BU\BU\CU_CU_CU_CU_CV]CV]CU`CU`ڠw}d@Z+Uo@TyQPuMJqJFmFCiE@fB=eA&?%A%A%A$@$?#>"=!<!<!<!<!<!<!< ;!<!<!<!; :877887546 7665443222233332243354212111122//00.,-,**))((((((&'$$#$%%%%&))**"+#-%0(1)2*1+1+././-.-.!,0!,0"-1%04(15)26)26*37)48,7;)9<)9<):@*;A,=C->D0AB2CD9EG:FH;GI>JL=KM=KM@NPBPRDQUGTXGWZIY\H\aJ^cMafOchSdjVgmXjmZlo_or`psbrudtwfu{ix~m{qvy~~~{zyyxxvvwvutrqo~n}hx`pUeP`BT=O7H2C.:*6'1$.!)&!                !"%%#!                       ~ ~ ~ ~~~}}{z{{{{zzyxvvvvvuttttt s q q p o m m k k k kkkkkiiiiiiii d d _ ^]]] \ [ [Z YS[%.T(1W-;K-;K/H1?I4DG5EH3EH4FI8GM;JP=JN@MQ@MQBOS?PW?PW?PW?PW@QXARYAQ[@PZCQ[CQ[CQ[CQ[DR\DR\BR\BR\BQ]CR^BR\CS]ES[ES[DTWDTWETZETZDS_ET`ET`ET`EU_EU_ET`ET`͓}muWA].ZvGRvPNrLKoKGkGDhDBfB?eA=c?9c:7a89c38b29`18_09^/8].;[/;[/;\,:[+:\):\)9[(8Z'7Z%5X#4Y$3X#1X#1X#0W#0W#0W#/V"/V"-T /S /S /S /S 1T0S0S/R/Q/Q2P"2P"2O$1N#1N#1N#1N#0M"-K$-K$&J$%I#%K $J)J )J +J +J ,K!-L",K!-L"*J#*J#)I"(H!%I%I%I%I)H)H+F+F'F&E"E"E"C#D#C#C"C!B#D"C$B#A%>%>&<'=&>'?'@&?$?$?#<";";!:!<!<!;!;!;!;= ><<8767877655 6 654333211234434323332111100/000/..-,+**))'()(''%%$%$%$$%%&''(( *",$.&2&2&2'2'0,0,,+-,#,/#,/$-0%.1'03(14)25)25(46*68*8:+9;*:=,A,>A1>B3@D9BE;DGGJ@ILAJMAJMDMPEPTGRVEUXGWZGY\K]`M^eO`gTbjVdlXgmZio_lpanrbosdquhswkvzmzq~quw|}|{{zyxxwwtssrrqm~l}dv]oObJ]=S9O2G.C):&7%1 ,)'#!                   !!                    ~ ~ } }{zzzzzzzyxvvvvuuttttttr q p p n m l l kllll k i iiihggg d d ` `___ ^[\ZYRY%*U*/Z.:I/;J/=G/=G0>F1?G3CF4DG5EH5EH7GJ:JM?JN@KO@KOCNR@PSAQT?PV?PVANZBO[BO[CP\CQ[CQ[CQ[CQ[DR\DR\@R]@R]@R]AS^BSZCT[DSYDSYDTWDTWES[ES[FT^GU_EU_DT^ET`ET`GT`FS_۽{aXb>Vq7c~DVvPRrLKmGIkEFgDCdACdAAb?=d7;b5;c2:b18_07^/9]18\0;Z0;Z0;[-:Z,5[*5[*7[(5Y&5Z%4Y$4Y$3X#3X#3X#3W$2V#2U%1T$0S#0S#/S /S /S .R0S1T1T0S2Q2Q2P"2P"2O$2O$/O!/O!.M#.M#.L%-K$+K$*J#*K!*K!*K!)J +J +J ,K!-L",K!,K!,J#,J#+I"+I"*H!)G )G )G +G*F+F+F)E(D&D'E&D%C%B%B#B#B&B&B'C&B(?'>'>'>+>+>)@(?$?$?"? ="<!;$<$<#;#;#;#;$<$<";!:987787774!6"5!433222112333333212222211100/0001/--++*)((''('&%$###"#"""#$$$%'!("*#,%-'/)/,/,-.,-,-,-+/+/"-1#.2&/3'04&15'26%26'48'7:)9<)8>+:@,;A.=C1>D2?E6AE9DH:EI;FJ9IL:JM;KN=MP?ORAQTDSYGV\DX]H\aI[eL^hOakPblUeoWgqXio[lr_ntapvcrxfu{iwm{qty}}|yxxwwuuutr~r~o{es]kT_OZCR@O8I2C/9*4(,%) %#"              !                        ~ ~{{zzzzzzzzyyvvvuuuuuuuttr q p p n m l l kll k k k i iiigggg d c _ ____ ^\\ZYTV%#T,*[08L19M/=G/=G0>F0>F2@H4BJ5CK5CK6DL9GOJR>JR=KS@NV@NXAOYCMZCMZDN[EO\BPZBPZBO[CP\DR\ES]BR\BR\BR\BR\BSZBSZDSYDSYFSYGTZGR]HS^FT^GU_EU_DT^DS_ET`FS_FS_ӧeqHUa8]xFdMSwSMqMGnGElEBhD@fB?eA:b79a69c38b29_48^39]28\19Z09Z09\-7Z+4Z)5[*6Z'6Z'5Z%4Y$5X#5X#5W$4V#2V#2V#1T%1T%1T$1T$/T/T/S /S /S /S 1S 0R1S 1S 2P"2P"2P"1O!1N#1N#1M&0L%/K$/K$-J%.K&)K%)K%)L$(K#+J +J /K/K.J.J+K,L +J *I)H)H+G+G)H)H'G(H(G'F&D'E%C%C%C$B#C#C%B%B%A%A'@&?&>'?'@'@%A$@???>!=!=#=#=%<$;#:#:$;$;#<";997665 5 5!6"744434322333434441211221122///000//-,,,*)(('('&%$####! !"#$$$$%&')+!+$-&,*!.,-.,-+,+,*.,0#,0%.2&/2'03%13&24%35'57'89):;)9<*:=-=@.>A/?B1AD4AE6CG7DH9FJ9JK:KL;LM=NO?PQARSCTUFWXHYZK\]K\bM^dPahRcjTekVgmZjm\lo`psaqtbrufvyiy|l|ru{{zxxxwvutttr~o}m{^qWjO\JWAR=N5E1A/6*1&*$(%"     !!"!                             ~ ~~ ~ ~ } }{z{{zzzzyxvvvvutttttttr qq p n m m mmmmml k k kiihgggee b b``__\[XXTV% T-(\/7K08L/=E/=E/>D0?E1?G2@H5AI5AI9BM;DO=GO?IQ=IQ>JR>LV?MW@MY@MYANZBO[CQ[BPZAOY@NX@NXAOYBPZCQ[CQ[DR\BR\BR\CQYBPXEOWFPXFPWFPWHQ\IR]ES]ES]DRZES[DT^DT^DS_ET`Ǎ[k;Xh8WuG]{MOuQJpLEmIBjFAgC?eA=c?;a=:b78`58a47`36_25^16]05\/7[/6Z.6\+4Z)2['2['3Z&3Z&6X%6X%5W$5W$2V#2V#1U"1U"1U"1U"1U"0T!-T -T -T -T -T -T 1Q#1Q#3Q#2P"0P"0P"0P$/O#1N#1N#3L&3L&2K%1J$/J%0K&+K%+K%+K$*J#,K!,K!.L-K/K/K-K-K+K+K,I,I.J-I-H-H-I,H*I'F'F&E$C%D$B$B$C#B#B#B$C$C%A$@$>$>$@$@$@#? ? ? ?!@!?!?!> =$<$<$;$;$;$;!= <9866!6 5!6"7"7"74444444432443422110/112221/////...-,++**))'(&&''&%% #!!""$%#$$$%&)!*"+$-& .)!/*.--,+,+,*,,.#,0$-1&,1'-2$/3'26%26'48&69)9<)9<*:=*A-?B.@C/AD1CF5EH6FI8HK9IL;KN=MP>NQAQTCTUEVWEXYH[\J\_L^aPagRciTekVgmXjm[mp]or^ps^suavxby{f}mpy{~~zyxxwusrttrpl|jz^qXkM]HX@P;K5A/;-4)0&*$($"       $$#!#"                            ~ ~ ~~}}{{{{{{zzzzyxxxvvvuuuttttt s q q n mmmmmmml k i iiihggge d a ` _ _ \ \[[ZZWX T)(]*6K,8M)>E)>E)>E)>E0>H1?I2@H2@H4BJ6DL8FN8FN9GO;IQLVLT>KW>KWAOYBPZCQ[CQ[CQYCQYAOWAOWDNVDNVGOVGOVFPXGQYGQYGQYFPXFPXFQ\GR]CS]DT^ů{~hUg1\n8[{OZzNMrPInLAlG?jE<<<< =!>!> <;!;!;#;$<$<%=$;#:#8!6!6!6 98 9!:!: 96566764322566533223222222200/..../--,+****''''''& $ # " "## ""#!"##$%()*$,&.+/,/,.++**)*,*,"+/#,0$-1&/3&/3'04'26(37)6:*7;)9<*:='<>)>@*?A+@B-BD/DF2DG3EH4FI7IL:JM;KN;LR>OU?QTBTWBV[DX]GZaI\cL_fObiNdiQglSjlUlnXoqZqs[qv^tyav}f{intv~~~|{zyxwvuvvsr~n{lyapZiP[KV?L;H4@/;+4&/#) &         !#$%&&"!                         ~ ~ ~ ~ ~ ~~~}}}}{{{zzzzzyxvvvvvuuuuttttt q p m mmmmmmm k k i ihggggge d a ` ` `_ ^ [ [Z YWXQ"&Z&4K*8O(=D)>E)>E)>E+>E,?F.?F/@G2BL3CM5CK6DL7EO9GQ;ISLV=JV>KW@MYANZANZANZCNYCNYDNVDNVCLWCLWCMUDNVAOWAOWCOWCOWENYENYCNYDOZCP\CP\߮kqXMe.\t=[yRXvOLqOGlJAkH>hE=f?;c:9a8;`89^69_48^38\08\09[/9[/7[/6Z.6Z.6Z.5[*3Y(4W'4W'5W$4V#4W"4W"3V!3V!3U"3U"3U"3U"3U"3U"/S /S .P$.P$.P$/Q%/R#.Q"0Q!0Q!0P"0P"/O!/O!1N#1N#1M&1M&.L%.L%+L"+L"*N#)M"*L )K-N,M-K-K,K.M,L ,L ,K!,K!+J *I+G+G+H+H+G,H+H)F)E(D&E&E%E%E&F$D$D$D$E#D#D"C!B A!A @=<::!;"<!<"=!;!;#;#;$<&>&>%=#:#:"8!7 9 9::::::8878652123577665443133222210.//....-+*))))''&&&&$" "!!!!!!"#$$%'()*#+$,'!/* -+ -+*,)+)+*,"+.#,/$..%//'11(22)25)25(46+79*98+:9,:<.<>-=@/?B0@C2BE4DG5EH6FI7GJ9IL:JMNQ@PSAQTEUXGWZJZ]L\_N^aQadTciVekVhkXjmZlo]or^ps`rufu{jyorv{~~~~}xxvuusrrqo}kzjy]nWhK[EUH/?I2@H4BJ5DJ5DJ8EI9FJ;HL;HL=JN=JN=JN?LP@MQANR=KS=KS=<=??=>!<!<!<"=">#?$?#>"<!;#:!8"9#:"9"9#:#:"; 99889753234677766442222221111//0.--++++**)(''''&& $ #!!!!""!"""$$&&'))#*$+(-*.+.++**)+*+*,+-,-/ .0!/1#13&24'35'48(59'89):;):;+<=-=@/?B/?B1AD2AG4CI5EH6FI6HK7IL9JP:KQ*:%3 .'#         !$%!"$ !$#& ) )(%                       ~ } }}}}}}}}}}}{zyyyxvvvvvvvvvvttttr q p o m mllll k kiiiiiihgee c c a ` _ _] \ [ \Z YWVQ$Z%1M)5Q';F';F(E*?F*?F+@G+@G-BI0CJ1DK1EJ3GL6HK7IL7IL8JM9JP9JP:KR;LS9KV9KV:LV;MWOV>OV?PW?PW>OV?PWAOWAOW@NX@NX巾mSa8Yt:]x>XvUSqPHlNEiKBgE?dB@d@>b><`<;_;:_77\47]26\15\-5\-5],4\+3[*2Z)2X-2X-5V,4U+3V&3V&2V#1U"1U"2V#2W"2W"2W"2W"2X 1W1W0V1S 1S 1S 1S .U!.U!0T!.R0R0R0P"0P"-Q%,P$,P$+O#-N$,M#+K$+K$+K$+K$-K$+I"+K,L -O+M*L)K,K.M.M.M,L +K)I)I)I)I(H'G(G(G(H'G%G%G%G$F(E(E)F(E&D%C%D$C&C%B%B$A"A"A ?>>>==!<!<#;#;#;#;"=#>$>$>#<!:#:"9!8!8!8!8"8#9!:!: 9 977534334676676553211000011///.--,,*++*(())'&% $ # " " " !!    !""%%'()* ,&-'.+-*,),)*(*(+*,+ -,!.-".0#/1%13'35(46)57(68)79):;+<=,D/>D3@F5BH7DH7DH6FI8HK8JM9KN;MP>PSAQTDTWGV\IX^J[aL]cMafPdiPfkRhmTkmUln[lr^ou`qwctzhz}nqux|~}}|yxxxwvsrqpj{hy^mUdEU@P7H3D/=,:'2!,%!  "##& ('$                    ~ ~ ~ ~ } }}}{{{{}}}}{zzzyyyxvvvvvvtt q q q q q q p p n m m ml k k kiiiiiihge d b c ` `_ ^ \ [[[[[XWO%Y$5I'8L&;D'G)?D)?D)?D*@E-AF.BG0CJ0CJ1DK1DK2GI4IK7IL8JM9KN9KN7JQ8KR8JT9KU9LS:MT;MWNX=MW>OU>OU@PS@PSBOUBOUALWBMX>NX?OY=OY=OY?OY?OY@NX@NXBLYBLY⩭cTc7Xw@^}FTsVPoRGjODgLAfD?dB=c?:a:9`98]56[36]05\/7],6\+3\(2['2['1Z&3X)3X)4W(4W(3V'3V'0V%0V%0W#1X$1X#1X#4W"4W"4W"2U 2U 1T2T!2T!2T!2T!/S 0T!0S$/R#1Q#0P"1P&1P&/P&/P&-Q&+O$-M&,L%+K$+K$,J#,J#,K!+J +K,L .L-K,K+J,L,L,L-M-L,K+I+I+J+J+J)H(F)G)H(G%F&G%F$E&E&E'C'C%C%C%D$C%B%B$A$A$A$A!>!><<;;#;#;%;%;$:$:%;&<%=%=$<#;"9"9!7!7 5!6!6#8#:"9 7!8775332234566664310011111220/...., +++)(((((('%% # $ ! !" !   !#%%'()++$-&-*,),)+()')'!*("+)$,,$,,#,/$-0&00(22)25)25(37*59+8<+8<-:>.;?0=A1>B2?C4AE6CG7DH5EH7GJ5JL7LN:LO;MP@PSBRUFVYGWZJZ]M]`P_eSbhPegShjTikVkm\kq^ms`pscsvhx{n~rux}~~~{zyxwvwvtrpn~j{hy[mRdCV>Q6I0C+:'6&1"-$       ! !"#$%!                        ~ ~}}}}}}{{{{{{{{{{zzy xxxvvvvutr q q q p p p p n m m mm l k kiiiihgee c c ` ```_ ^ \ \ [ [Z Y V UO&X$4K&6M';F';F(>C(>C)?D)?D+?D,@E.?E0AG0AG1BH2CI3DJ5EH6FI8HK9IL:JM;KN9JP:KQ;LS;LS;LR;LR>MS@OU@OU?NT@PS?OR?OR?OR@NV?MU@NX?MW>NX>NX?OY?OY>NX?OY@NX?MW@NX@NXݚoTOb4\{I^}KTrYNlSHjKFhIBf@Ae??d<!>"<!;!;!;#;#;#<#<%;$:$:%;$<$<!;!; 9656 5!6!6!687886765432234346433221123332210//.-++++*))))))(&& $ " ! !      !"##$%%'())$+&-(,'-'*$)&)&)+*,+- ,.#,0#,0"-1%04$15%26#28&5;'6<)8>*9?,;A-D/>D0?E3BH4CI3DJ4EK6GM6GM8IO:KQH9C2:,4)1$,&"    #!  !                  ~ ~ } }{{{{{{}}}}{{{{{zyyy xvvvvvvttr q q q p p p p o omml k i iiiiihge d c b ` ``` ^ ^ \ [ Z [Z YUUN'X$4K'7N'C*>C->D->D+?D,@E+?D-AF0@J0@J1BI1BI4CI5DJ6EK7FL9HN:IO;JPNQ=MP>NQ>NQ?NT?NT=OR=OR;PR'>#?$@ @> =<!;!;!<!<!< ;":#;&9$7%8':%;%;!;97645 5 5 6 6 766665543333222343221///1222220/00..- ,+,)))())( &% $ # "   !!!$#%%&' )",%,','+()&)')'*)+*+*,+!-/!-/".0$02%04'26&37'48'7:)9<)8>+:@,:B-;C1>D2?E2BE3CF4DG5EH7GJ8HK:JM;KN>NQ@PSDQUGTXKU\NX_M[cO]ePbeRdgPgiSjlTkmVmo]or_qtfvyiy|ru|||zyxwwvtsonfzauVfScGXAR7H2C+:'6#0,%#  #! !$$!                   ~ ~ ~~~}}}}}}zz{{{{{{{{{zy xvvvvvutttt q q o ommmmmml k k kiigggge c ` `````__ \ \ \ \ Y XTSN'V$4K&6M*E->E->D->D.?E/@F0AG0AG1BH1BH2CI3DJ4FI5GJ8HK:JM:HP;IQ?LR?LR?LP?LP?LP@MQ>MS?NT>OV>OV;QV;QV;QV;QV@NV@NV@NVAOW@NV@NV@NV@NV@OU@OU@PS@PSƄybzIQi8VwMXyONoRJkNGiJDfG@g@?f?=e<'>"@"@?>==<<!=!=:9!9!9 7 7 7!8"9"98754343454445454431211//010010//0/00/000///...-,,,)))(( ''&&&##!     "#%&'(*",$-%.&-'+%*&*&)(*)+*,+ -,!.- .0"02#13$24#45$56&78(9:)9<*:=+:@-A/?B1AD2BE7DH7DH8EI:GK9IL;KN=MP?OREOVHRYJT[NX_L[aN]cMbdPegQfhTikVkmWln]lr`oucrxhw}p~tx|}||zyxxwwuupni|cvYiRbEX@S5I/C(9$5!0,&#!#% #$%$                        ~ ~{{{{{{{zy xyz{{{{{{z yxxvvvvvvttr q q q p o m mmmlll k i iiigggg d c ` ```__] \ \ \[[ Y YSSO"'Y(3L+6O*E+@B+@B+@B,AC/@F0AG1?G3AI5DJ5DJ6FI6FI7FL9HN;IS;ISLT9NU:OV:PU9OT>OV>OVAOYAOYAOYAOY@NX?MWBNVBNV@OU@OU@PS@PSνwYrEVoBYySVvPNoRIjMDiGBgE=eA:`<;_9:^88^38^37^16]05\-3Z+3Z+3Z+2Y*1X)/W&/W&0V%0V%2U%2U%4V#4V#4V#3U"3V!3V!1V!1V!/V"/V".X".X"/X$/X$1X$1X$/V"/V".T#.T#,T#,T#,T#-U$.S$-R#-O#-O#-O#-O#/O#/O#/N$/N$,M#,M#'N!&M (M(M+K+K*K+L.L.L/L!/L!.J!,H,J+I+J*I(J'I'I'I&H%G)G)G+F+F)F'D%D%D&D%C%B%B#B!@==;;!<!<!<:99776567998521344433223322100000....////..///.--//...--,++,-+**)(((( & & $ #""" !   !#$$%&)!*",$-%.&-%)&(%(')(*)+*!++",,#--%//%21&32#45$56#67%89(9:):;+9A,:B-;C/=E0@C2BE3BH5DJ5EH7GJ9IL;KN;KN>NQ@OUBQWGS[JV^KYcM[eL`eOchPdiRfkVgnXipZkr]nu`qwev|l|rux|~~~~||{||{zyyvtsrjzgwYgTbGWBR4H0D'9#5!0,(%!  $%"                             ~ } }}}}}{{zz xyyz{{{{{{z y v vvvvvvut s q q q q p o m m kll k k kiiiig fee d c ` ```__ \ \\[Z YWVRRM%&V*3K-6N*E,>A-?B/>D/>D0>F0>F2@J3AK3BH5DJ5DJ5DJ6DN9GQ:GS;HT>JR>JR@JQ@JQAKRBLS=KU=KU;MX;MX;MW;MW?MW@NXANZANZ?NZ>MY@NX?MW@NV@NV@OU?NT@OU?NTɢmo\vT_yW\y[WtVJlSGiP>jI;gF9fA8e@9d?7b=7_;6^:5`43^25_/3]-5\-4[,2Y*2Y*.Y%-X$-X$-X$/X$/X$4V#3U"3V!3V!3W3W3V3V1U"1U".W#-V"-W!/Y#/Y#0Z$/X$/X$/X$-V"-V"+T ,U!,U!/V"/V".S$-R#.O%-N$-N$-N$/O#/O#1N#1N#-O#-O#(O"'N!'N(O )N(M*M*M*M+N-M!-M!.J!,H,H+G)I(H(I'H%I$H&I%H*G)F*E*E(E'D#F#F#F!D#B#B!@ ? >=== ; ; :98786657888654333432222331111110/. /.-./1/.////. -....----,+++,,,++**) ' & & % % " " !"   ""%%&')+ - /"/&-$*&)%(%*' ), ),!*-"+.#.,%0.$1/%20$41%52%65%65(68*8:-8/<@1>B0@C1AD3DE4EF5FG6GH9GI;IK?KM@LNDMQFOSHQULUYLW[OZ^O\`R_cVbdXdf\eh_hk`ilbkndqpjwvp|~x~~}~~{yxxutrrjzfvXiSdCW?S2G+@#6 3-+)%          ""!!                              ~ ~~~}}{zyyxxyyz{{{{z x xvvvvvvvut s p p p p n ml k k kkkiiiihghhgge d a _ \ \] \ \ \ \ [ Y YVVRSN%&V(3K,7O(=F'E*?A+@B-?B-?B/?B0@C0?E2AG0AG0AG3BH5DJ5DJ5DJ8EKMSMS?NT@NVAOWAOY@NX?MW?MW>LT?MU>OV=NU?MU?MU}~|||~{}{{zz|~{yz|x{yIy(X_]H,jUM{ZLzYQwYLrTFnRBjN=iF;gD9fA8e@6c>4a<5a94`84_33^24^.3]-0\,/[+.Z*-Y),Z%,Z%+Y$+Y$-X$,W#2W"1V!3V3V4U4U7V8W 4W 4W 0W"/V!.X"/Y#0Z$/Y#2Z"2Z"3Y!3Y!1V!0U 0T!0T!1T$1T$0S$0S$/R#-P!-O#-O#/O!/O!/P /P /O!/O!-O#,N",O ,O ,O+N(N(N&M'N)M!(L +J *I*I)H)I(H(J'I%J#H%H%H'F&E&E%D%D%D%D%D%D$C$C#B#?#?> ?=<:::998777787664322333322121100//01/. --,,-./..,----,,...-------..-,-+***(''% $ " "!!   #$%&&()+ ,#-$.'-&+'+'*(+)*,+-!-/!-/ .0!/101!23!23#45!45#67'89(9:):;+<=*A)AA)AA*BB+CC1DE1DE5EH5EH7GJ9IL;KNMS=LR=MP>NQ>NQ?ORNX>NX6a<5`;4_:7^75\54]03\/0\,/[+.\'-[&,Z%,Z%+X&+X&,W%,W%2V#2V#3U"3U"4T 4T 5V5V4W 5X!.X .X .X"/Y#1X#1X#4Y$3X#4Y$3X#2V#1U"3U"3U"3S%3S%3S%3S%0S$/R#.P$.P$/O#/O#/O!/O!-O#-O#-N$-N$-N$-N$-N$,M#*N"*N"'N!'N!(L 'K*I*I+G+G+G+G(J(J'J%H%H&I&H%G$F#E#E#E%D%D'D&C%B$A%>#<!<!< ;:99977888776633210011210//010010000/.--,++--,,+-.----.-,-..//....-,+***))'' $ # # #" !   "##$$&(!)"*#,%-)-),*,*+,,--.-.-0.1/2 03!14!14 25!36!36"47%58&69(8;)9<,9=-:>,A/?B0@C0@C2AG3BH7DH7DH;FJOU?PV;PWG)>G)>E)>E,?F,?F,AC-BD.CE.CE2@H3AI4BJ5CK/EJ/EJ/GM1IO4IR3HQ6IP7JQ;KNeE?eA=c?;b;9`98^:7]96^54\36\15[04\+3[*2['0Y%/X$/X$/V'/V'.U&.U&2U&2U&6T&6T&6U#5T"3V!3V!2W"2W"/V!0W"0W"1X#3W$3W$5X#5X#5X#6Y$5W$5W$5V&4U%4T&4T&2U&2U&/S'.R&.R'-Q&.O%/P&.P$/Q%-Q%+O#+O$*N#.M#.M#.M#-L"+M!+M!(L (L (L!'K )I)I+H+H-H-H+H+H+I*H(G'F%G%G$E$E%D%D'D&C&C%B$A#@">!=!< ;!9 887767777554432111122222122211211..//---,-.--,---+,,--,,-.--.-.-,-++****)%%% $ # "    !!"#$$&& )#)#*$+(+(,),)-*-*-..//0/0/2 03 03"25"25#36#36$47'48(59)6:+8<+8<+8<+:@,;A+D->D->D0>F1?G3AI4BJ9CK:DLGRFS@HU:BO:CN?HS=FQ=FQ9CP2H/=G1?I-:F/NXER^IVbGT`HUaHUaMZfVhsRdoNdoPfqTguUhvViwXkyYk{VhxXj|VhzZm{\o}Zky\m{^l{^l{co~frar]n|]m}^n~_q|btXnySitXky\o}hvdrdofqhskvesft`q`qgrdoltltirfobpbparbsdsfufudserdqgthuivkx^r]qVfO_DT>N1C+=#3/)$                                 ~ ~~~}}{{{{zzxxyyzz{zxxvwyyxxttr p m mmml k k kiiiiiihggggge d d d c b _ _ \ [ [ [Z Y W WUUSTO$Z$3N(7R(;I(;I(G)>G*?H*?H,>H-?I0@J1AK3AI4BJ5CK5CK,FL,FL)GO,JR.JR/KS5JQ5JQ;MP;MP;LSb>+=@,>A(?A)@B*AC+BD.CE0EG3EH3EH7GJ8HK:JMTY@V[BZZC[[D[]G^`MchPfkTipXmt_pvctzfvyhx{k{~l|pquvwxzz}|}zw{|~~}~}~~}}}|zvvvvutvvsupl{l}nm~l}l}l}cu`rXfQ_FTBP5D1@'6!0*&                                ~ ~}}{{{{z{zzyxyy{{{zyxwwyxvutt q p n m m ml k k kiiiiiigggge d c c c c c b _ _ \ [ [ [Z X V WUURRM#W$3L)8Q)=H)=H+=G+=G->E->E.>H/?I+@I+@I-BK.CL1EJ1EJ6FI7GJ5FL6GM1JN3LP1LP1LP6LQ7MR8NS9OT9NU9NU;SY=U[7V[5TY4RZ5S[6T\5S[8UY8UYW[?T[@U\@Y]>W[WY䲺}sUfKUtQ]|YPs^JmXBjN@hL@eC?dB:`<;`8:_77\46[36[35Z25[04Z/5[*4Z)5Z%5Z%3W$2V#3V&3V&2V#2V#2U&2U&2U&2U&2V#2V#/V!/V!/V!0W"/V!/V!2V#2V#3W$3W$3X#3X#3X#5Z%5X(5X(4W'4W'5W$5W$2U%2U%0U&1V'.U(/V)-V)-V)-U*,T)+S*(P'+N&*M%,M#,M#.N".N".N -M-M-M+K+K*K)J+J+J,J+I*H*H)G)G)F*G)F)F(E(E)D'B&@%?#?#? ?> <; 886566556667776766542223444444444433222210/000/.,+*++++*))(())*+++,+,+**))**)('&% $"   "#$&'( *"+#+%,&,'+&+)*( **!++"+.#,/#,0$-1&/3'04%04'26&46(68'89(9:):;):;*:=,H0>H.?F0AH/CH/CH4CI5DJ5EH6FI5GJ5GJ4HM6JO7JQ7JQ9KN:LO=MP>NQ?OR@PS=OY=OY8Q[7PZ7PY8QZ9TX9TX;TXfC;c@:b>7_;9a86^55]45]45[05[05\/4[.3[*2Z)5Y&5Y&5V&5V&5V&5V&4V#4V#4U%4U%4U%4U%2V#2V#0W#0W#0W#1X$2V#2V#4V#5W$5W$5W$5X#5X#5W$6X%6W'6W'6W'5V&5U'5U'4T&4T&4T&4T&2U&2U&1V'1V'/U*/U*/U*,R'.O%-N$/N$/N$/O#.N".N ,L-O,N,M+L,K,K+J+J,I*G)F)F(E(E(D(D*D*D+C+C(A%>$<#;#<#<":": 8 8"7"7654356667888788775445677688777775623323333220/--,,,+))((&&'(()***)**)))))))(''&&% $ !  !#$&(!(")#*$+%,&+%)')' ), ),!*-!*-$*/%+0$-1%.2$/3'26%35(68)79*8:+8<,9=+;>,@+@B,AC.CE/DF1FH1FH2GI4IK5JL9KN:LO?NTAPVDSYFU[BX]E[`G^`JacKbdNegSdjVgm[lr^ou`v{e{m~ursx{~~~~}}~{xy|}{rrrsqjyXfR`DS=L1C+='6"1!)#                        ~~}}{{{{{zyyyyyyyyyxwvwvvvt s q qr q p o o om l k k i iiihgggee b b```aa`__] \ \ Z W W U USSOPL&'W,6K.8M-=G-=G/=E/=E1=E1=E1=E1=E/>D1@F2AG2AG2AG4CI4DG5EH3EH3EH7GJ7GJ>HP?IQ?IP?IPAJNBKOCLPDMQBKVCLW@MY?LX@NVAOWAPVAPVAOWAOWCMZCMZCNYCNYDQWERXERXDQWDQWERXۡgzYObAYtO\wRSsTOoPHjKEgH;fA9d?6b94`73_61]43^22]13[03[03[01Y.2Y*1X)1Z&1Z&1X$1X$3W$3W$2V#1U"2U&1T%1T%1T%0W#0W#0W#0W#0V%0V%2U%2U%3W$3W$1X$1X$1X#1X#3X#4Y$6X%6X%6W'5V&3V'3V'3T$3T$3U"3U"3S%4T&5U)5U)2V+2V+/U*,R'-P(,O'/N$/N$/O#/O#-N-N,N,N,N*L*L*L)K)K*J(H)F(E'E'E'E'E)D)D(C'B&?$=#;#;#;!9"7!6 5!6$6#5!6!66667788999::!8!8!8 78898898887878889546653331200/....,*)''&%$ %''()(())''(()))(('&&&% " " !"$&!'"(#*$*$+%*$(&)')))) ), ),*, ,.,0"/3!23"34!45#67$69&8;)9<)9<+;>,D->D/>D/>D/>D/>D0@C1AD1AD2BE0BE1CF0EG0EG/FH/FH1FH2GI8FN9GO9GO9GOLV>LV>LT?MU@NV@NV@NX?MW@NX@NX@NV@NV@OUAPVAPVAPVCPVCPV՞jxX\jJYvSYvSMrRKpPBiO?fL7fB4c?2b:0`81`40_3.^0.^01\01\03[02Z//Z-.Y,-X+-X+/Y)-W'/W&.V%1T%1T%0S$0S$/U$/U$/U$0V%0W#0W#0V%0V%/V"0W#1X#1X#1X#1X#1X#1X#3W$3W$6X%6X%4W(5X)1U)1U)0T(/S'2R$1Q#2R$3S%2U&3V'3T*3T*1U*.R'-Q&,P%0P$0P$/O#.N"+N*M,N+M+M+M)M(L'L'L'I&H(E(E'E'E'E&D&C&C'B&A#?!=!;9!86 544!6!6!66788::::;;;;;;!:!:;:=<=<:999889889876666664533211000.-,+*(& %$%"#$%&&&&&'&')))())'' %& $%!#$%()* )"*#)$)$(&)'))))+)+)+) -+!.-#0/#13$24#45$56&78'89):;*;<*;<,=>.>A/?B0@C1AD0BE2DG5DJ5DJ7FL9HN;JPMSAPVDSYFU[HX[JZ]L[aN]cR^fUaiWdjZgm]jnanrhuykx|p{uvzxz|~~|{yyxxwwuuj~dxVhQcAU:N.A':"1-'"                              ~ ~ } }{{{{zzyyyyxxxxxyyyyyvvvvvvuut s p o l l k k k k k k i iiiihgggg d d ` ````___] \ \ [ Y X U USSNO J'*T+7F-9H,=D,=D,=C->D-?B-?B+@B+@B,AC-BD.@C.@C1AD3CF3CF3CF0EG1FH3DJ3DJ4EL5FM8GM9HN9HN:IO=JP>KQ>JR?KS = <; 98765545 7 7 : :;;==>>??>> = = <!=?>>=== ; ;9877877877665 666453331332200.-+***' & " !!!  !##"$%''*))(& %&'% $!!!#&')!*"(#(#)&)&)&)&')(**)+*,+.--/!/1"/3$15#36$47&78'89):;):;+;>,D1@F2AG4CI3DJ4EK5FL7HN9JP:KQE/?B/?B/?B/?B/?B/?B,@E,@E->E->E1?G1?G2@H4BJ4BL5CM3DK3DK0EL0EL1GL3IN7IL8JM:HP;IQ;ISJR>JRLT>LT>LT?MW?MW?MW>LVLT>LT@MS@MSͼ~QkBSmD_|Y]zWOqXKmTBjN>fJ9eD7cB4a<3`;1_70^62[42[43[22Z11Z-1Z-.Z*-Y))Z))Z)*X*)W)-W',V&-T%-T%+R#+R#,T#-U$.W#.W#.W#.W#0W"/V!1W1W2X3Y 1X$1X$1W&2X'3Z&3Z&5Y&5Y&8Z'7Y&8Y)6W'3V'2U&/T%-R#/T%0U&0U&0U&0U&/T%2S#1R"0Q!/P -P!-P!/O!.N -M,L+L)J+J-L,O)L(K&I%H$G'E&D(C'B&A&A$=$="=!<;;:877 7!89 :;<=>?>@ACCCC@@>?? @ @><<;;<<:989 7 76666334 5664444433332210/... ,* ( $ "   ! "#%%)*)))((('&% $    "%'(!)"(#(#)&)&'&'&&(')*),+-,.-!-/".0#.2%04"25#36%58'7:*7;+8<+;>,D0?E1@F3BH5EH6FI5GJ6HK9KN;MP:OQV:R0F*@'6#2!)#!                                              ~ ~ ~ ~ } }{{z{zzyyxxvvvvvwyyyxvuuvuvuut s o ommlll kl k i iiiggee c c ` `__ \ \ \ [ \ [[\Z Y W V V VVUPP K#*U(8H*:J,=D->E/?B/?B/?B/?B/>D/>D->D->D->D.?E2?E3@F4@H4@H4BJ4BJ1DK1DK0EL0EL3HJ4IK8HK9IL9HN:IO:IO;JP;JP;JPMS>LT>LT>LT>LTLT>LT?LR?LRƷNiDOjE]|YXwTNqVKnSChN@eK9eD7cB5b=3`;4_:3^94Z64Z65Z23X01[+1[+-Y)-Y),X(+W'-V)-V)/V).U(.U(-T',S&,S&.S$/T%/V"/V"1V!1V!2U2U2V3W4X5Y 2Y$2Y$2Y%2Y%4Y$4Y$6Y$7Z%7Z%7Z%6X%6X%3V&3V&.U(.U(.U(.U(/S'/S'2R$1Q#3R"2Q!1O!1O!.N".N".N -M.M-L+J+J)L*M+M)K(J%G#E#E&C&C'B&A$>$>#<#<":!9 :9999 : :!;=>??AABACDEFFFBA>? @ @?? <;;;::88887655333345653355433223322210.-, * & $ " !   #$(((()'))('% $  !#$&' (!(#(#)#)#(%(%'&('*(+)!,*#.,",,$..#/1%13#43$54%65&76(9:):;*;<,=>.?@->?/?B0@C0@C3CF4DG5EH6GH8IJ8KL:MN9NOUWAXZCZ\G[`I]bL_fNahPdiSglVjo[otcsvhx{p{tvy|~}|{{|{~~zzxxvuutqm|[jSbCS>N2F,@'6"1 (#                                           ~ ~ ~ ~}}}}{{zzwvvvvuvvvvwwyxtttttutt q p n m m mll k k k kiiiiggd c c c c c b a \ \ \ [[[[[ Y Y W W U USSPP!O%+Y(7J*9L,=D,=D1>B1>B1>B1>B.=C-E.?F.?F0>F1?G2@H3AI1BH2CI1DK1DK1CM2DN5FM5FM7GJ8HK8HK9IL9KN9KN;JP;JP;KNMS=LR=LR;;;::9877665554433343233443211222221//-,+*( ' % % " "      "$%'****(' $ $"!     "$$& '"(#(#(#)#)#(%(%'%(&)'+) +)"-+#--$..#0/%21"34#45$47&69(8;)9<)9<+;>->?.?@/?B/?B1@F2AG4DG5EH4FI5GJ8JM9KN9NP=RTUWAXZCZ\E[`G]bI_dLbgNdiQglTjoZpu_sxcw|l{o~ruxz|~|zzz|}{zxxxxwvsp^lSa?M?M4E/@,7'2#)$                                              ~ ~ ~ ~ } }{{{zyyxxvvvvvvvvwwwvttttuttt q q m mlll k k k k kiiiiggd c c c c b _ ^ \ \ \ [[[ Y YYYWVSSRRRR!P"*Y&7K(9M(=F(=F-?B-?B/?B/?B/>D.=C/=E/=E/=G/=G1?I3AK2AG3BH/BI0CJ1CM0BL3CM4DN6EK7FL7GJ7GJ6HK7IL8JM9KN;KN;KNKQ?LR?LR=MP=MP>NQ>NQ4b:3a92`80^60\3/[20[//Z..Y--X,.V+-U*/V'/V'0T(0T(0T(0T(-T'-T',R',R',S&-T'-T%-T%0T!/S 1T1T3V!4W"5X#5X#6Y$6Y$5X#5X#5W$6X%7Y&8Z'9Z*8Y)4W'4W'/W&/W&/W&/W&/V'.U&1R(/P&0O%/N$1N#1N#3N#3N#2N1M/L.K-J,I,J+I,J+I)H)H%E#C#D!B?=#;":%7%7"7"7!9":< =? @ A ACDEFFF!F!F%D%D%E%E#F#F D D A A!B!B#B"A!?=;::::998787665444434333344432132110000..--**)) & #      #$&&((&&%%% $      "#$')* * * *"*"(%(%'%(&)'+)!,*"-+#.,%0.#/1%13"25#36#36%58(59+8<,9=-:>.;?/<@1>B1>B2?C5BF4EF5FG6GF8IH:KJ;LK=MPAQT?QTBTWBWYDY[G[`I]bK`bNceRdgUgjXjm]orcuxfx{l{prvxz}}|||||zzxxxwwvro\mQb:M:M1C,>'6$3*&!                                   ~ ~}}}}}}{{z yxxvvvvvvvvuvvvtttttu s s p o l k klll k kiiiiiihgeee d b b_ ^ \ \ \ \ [ [ Z[ Y Y V VSSRRPP$Q#,Y&7K'8L(D->D/>D/>D.=C/>D/=E/=E/=E0>F1?G2@H3CF3CF0DI0DI/AK1CM1DK2EL5HI5HI7HI7HI9IL:JM9HN:IO;KN;KN9KN9KN:LO;MP=MP=MP=MP>NQ=MP=MP=MP=MP>NQ=MP;MP;MP粻xpId?\wRVy^RuZIoXFlUAjK?hI;fA9d?5b=3`;1_7/]5/[3/[3.[/-Z./[+-Y).X(.X(-W',V&.U(.U(/S'/S'/S(/S(.R'.R',S&,S&-T%-T%.U!.U!2U 2U 3V!4W"4W"5X#5W$5W$3W$3W$4X%5Y&7[(8\)9Z*9Z*6Y)6Y)1Y(0X'0X'/W&1W&1W&4T(2R&0P$/O#1P 1P 1P 1P 0O.M.J-I.I-H-H,G*H)G$F$F#E"D!B@>=99 8!9 :!;<=?ACD CB D!EFF#G$H(G'F(E(E(E'D#E#E!C B$@%A%B&C%B$A!> =<<=<988777666654444422333444322212000/00. - ++**' $ !!        ""%%&&'&%$""!#$&)+ * +!*#*#'%(&(&(&('*),+!.-!.-"/.#/1$02#04%26&37(59)6:+8<+8<-:>.;?/<@/?B/?B0@C2BE0EF1FG1II2JJ5JK7LM;LR>OU@QWBSYDVYFX[IZ`K\bN]cRagTdgWgj[kn_oravxdy{h}krvxz}}}~~}}yxxxwupo\mTe;S8P-C'=%6#4*'"                                        ~ ~ } }}}}}}}{{z y x xxxvvvvvvvvvvttrrtt q q n m l lllll k kiiiiiihgeed b ` ` \ \ \ \ \ [ Z Z Z Z Y Y W WVUSSOQ'Q!-W'9I);K(=F)>G->D->D/=E/=E.F1@F1@F0AG0AG,BG,BG.CL/DM/DK0EL1II1II3HI4IJ9IL:JM>IM>IM:IO:IO7KP7KP6LQ6LQ8MO9NP;MP;MP=MP=MP>NQ>NQ=LR=LR:KQ:KQ梭p{jGdA\yVZzaUu\LqVHmRCkH@hE;fA:e@5c;3a93_70\4/[2/[2-Z.,Y--\++Z)*X**X*/V).U(/S'/S'0Q'1R(1R(0Q'0Q'0Q'+R%,S&,S$,S$-S".T#-T .U!2W"2W"3X#3X#3X#3X#3W$3W$5Y&7[(8\)8\):[+:[+9Z*9Z*5X(5X(3V&3V&5U'5U'5U'3S%0Q!/P 0O/N0O0O/M-K.J,H+H)F)G(F&E%D#E#E"D B>=;;89 :!; ="?A BDE!E!E#F#F$G$G"G#H$I%J'I&H+F*E*E)D#E#E!B@">$@%B&C%A%A?>>=<<88777766665443221122334443 0 0.//0///..--,+*( & " "       "#&&((&&% #  "$%'())#)#)&)&)&)&('('()*++-,.!-/".0#/1$02$15&37'48)6:)6:+8<*9?+:@,D.?F0AH.EG/FH0HH2JJ5JL7LNE(=D+>E+>E-=G-=G-=G-=G->E->E.@C.@C0?E1@F1?G1?G,AJ-BK.CL/DM/DK/DK0HH1II4GH5HI9IL9IL:GM:GM:HP:HP7KP7KP5KP5KP:KR:KR=MP>NQ=LR=LR>LT>LT;LS;LS8KR9LS嗧gwl?bGOrWR|`Mw[HrVDnR?iM=gK9dE8cD4bA2`?1]<:889:<!?ABEEFG!G#I'H'H%H$G#J#J%I&J)I(H)G)G(E'D#D"C!A @"@#A'@(A'@&??>== ; ;8887775433232222222233332200-./0//.-----+*&%$#          !"&'((& #    #$$&')*"*"*$)#(%(%&(&((**,+- ,.#,/#,/$-0&/2'26'26)48+6:+6:,7;+8>,9?,D/=E2@H4DG5EH7GJ7GJ9IL;KN=JP@MSCPVERXFU[GV\JY_M\bN]cQ`fTdgWgj\lo`psdvygy|j|nruwy~~}}||zywvst_tUjDX>R.F'?"85-)$                                      ~ ~ } }}}}}}}{zzzzzz{zzxxxyyyyyvvtttttt q q p o o omm kl k kiiiiiiiihg c b ` `____ \ [ Y Y Y Y Y Y Y YVVRQJQ"*K(0Q';F(G)>G)>G+=G+=G+=G+=G->E->E.?E.?E0?E0?E1?I1?I-BK.CL/EJ/EJ/DK0EL2EL2EL5FL6GM8GM8GM8GM8GM:HP:HP9JQ9JQ9JQ9JQLT>LT1]:/[8/Z5/Z5+Z.*Y-)Z))Z)*Y'*Y'-X&-X&,V&+U%-T'-T'-S(,R',R',R'+Q&+Q&,R',R',R',R'.R'.R'1S'1S'1W&1W&2Y%3Z&2Y%2Y%6Y)6Y)8X*8X*8X,9Y-8Y)8Y)5Y&4X%3W$4X%6W'6W'5W$4V#2T!1S +P!*O ,O *M.L,J-I+G(D(D%D%D$C#B#@!>;::: 9!:"<$>"B$D%D'F%F%F"I#J(J)K)K)K%I%I%I%I'I'I(G'F)F(E&E%D#E#E!A!A @!A%@%@$?$?>=::9:887665322222221022222210//.--.-..-..--.-**)(& %# !        $%''% $     !"$&'( '$(%*$)#(%(%&(&()**++-!-/!-/!-/!,0$/3$15&37&37(59)6:*7;)8>*9?+:@.=C.=C/>D0>F2@H4CI5DJ6FI8HK7IL9KNMSAOYCQ[DU[FW]DZ_F\aG]bJ`eNdiQglWln\qsauzey~j{nruwz{|~}}|{|}|||yyxwsq~et[jH[CV3G.B)8%4"/+#                                            ~ ~ ~ ~~~~~}}zzzz{z{{z yvvvwwwwvvvttttr q p p p o p p n m k k i iiiiiiiiigg c b ` `____ \ \ Z[ Y YZZ Y YSSONJS%-N(0Q+:F,;G+;E,E->E->D.?E.?E.?E0>F0>F1?I2@J3AK4BL5CM5CM1CM1CM0EL1FM1FM1FM2HM2HM3JL3JL6KM7LN9JP9JP;JPMSfJ9dE8cD6b?3_<1^90]8.\4-[3+Z.*Y-,[)*Y')Y$)Y$,Z%+Y$-X&-X&,W%,W%,U(+T'+S(*R')Q&)Q&*R')Q&,S$-T%-U$-U$,T#-U$.V%/W&0Y%0Y%0Y%0Y%2Y%2Y%2X'2X'5X(5X(6X%7Y&5W$5W$3V&3V&3V&3V&3V&3V&1T$1T$*Q"(O &N%M+L)J,H)E'D'D&C%B$@#?#="<;;;<>!@"B#C#E&H&G'H'I'I(J(J'K'K%L$K$K"I%J$I%G%G&E&E%D%D%D%D"C"C"B!A @ @$>$>#>#><:99887755445444333311113322210/00//.---.-,,,+ **))'&$#!        "$&&%$#   !$%%'!)#)#*$)#(%(%'&'&(*)+ ),"+."+."+.".0$02$15%26%26'48)6:*7;)9<*:=+;>-=@.>A/?B1@F2AG4CI5DJ2GI3HJ6KM7LNE.?F.?F.?F/@G0AH2@H3AI4BJ4BJ5DJ5DJ/EJ/EJ.FL.FL/HL/HL0IK0IK1JL1JL5LN5LN9KN9KNMS;LS"=!<!;!;; <>@EF!G"H$G'J)H)H)J)J(K'J(K(K(K(K'J&I&I%H%G$F$E#D%D%D%D#B#B#B A@@@ = = <;:899988765554333333322233222000000//----.---,+**))('%% # !      !#%$ $ # ! "#%& '!*#*#)#)#(%(%'&('*)*)"),#*-#*-%,/"/.$10&32'43%26'48'6<'6<(9:):;,=>,=>.>A/?B1AD3CF4DG5EH4FI5GJ7IL9KN9KN=OR?PVBSYAXZAXZD[]G^`H_aLcePefTij[no_rsdvyj|mpruwz~}|{{{zyyxxyxusnm~_vVmE`>Y0L+G)?%;$2,"                                                 ~ ~ } }{{{{zzyyvvvvvwvvvvttttttr q m mmmmmll k kihgggggg de b b``__] \ \ \ \ \ [ [ Y Y W WVURROOJ T'/K,4P-;E.H,>H,?F-@G-@G.AH0CJ/BI1DK1DK/DK/DK0EL/DK1FO1FO1FM2GN2GN3HO8IP8IP;JP;JP;JP#A C!DH I"I"I)K)K)I)I)K)K'J&I'J'J(J'I)I)I(H'G&E&E%D%D%D%D%D$C"A#B@?===>==;999877765554433211223222222210000/. ,,------,+**))'%%%##"!          $###""!##$& '!(")#(%(%(%(%(%)&'))+*,+-!.-!.-!-/#/1"/3%26#28%4:'6<'6<(9:):;,;:/>=.>A/?B0>H1?I3AK5CM5EH8HK7IL9KN:LO=OR>QXAT[AXZCZ\F[]I^`J^cNbgNegSjlWnp\su`u|ezl~nvxy{~~||zy{z||vur~q}gw\lL^FX9L5H3A-;+2%,$                                                      ~ ~ ~ ~}}{{z{zzyyvvvvwwvvvuttttrr p p m mmml k k k k khggggge d a ` ` `____] \ \ \ \ \ [ [ Y Y W WUUP OOOK! U*2N-5Q*C*>C.NQ=MP=KS=KS>LT1a;0`8/_7.\4.\41Z3/X1.Y-.Y-/W,/W,.V+.V+-W'-W'-X&,W%+S(+S(-Q+-Q+,Q),Q),Q),Q),R'-S(0U&0U&/W&.V%.W#/X$/Y#/Y#0Z$0Z$0Z$0Z$0Y%1Z&4Z)3Y(8X*9Y+8X*7W)2W(1V',S$+R#+P!*O .N ,L+M)K-J,I*H)G(E'D%B#@">!=":#;!;#=!@%D F"H!K!K#K#K$M$M$M$M#M#M$K"I%H'J)I*J)I)I)G(F(E'D%D%D#E#E"D!C BA?><<=>>=;;9988888666544333222222221000./0/.-,-,,-,++++****('&& $%% # !          """#$%%"&#(")#(%(%(%(%)&)&('*)*),+"+.#,/#,/%.1'04)26'18*4;)6<)6<*8:+9;-:9.;:2;>4=@3=D5?F3BH5DJ5EH7GJ9IL:JM;KN>NQAPVCRXETZGV\JY_L[aN]cQ`fTefXij^onarqfvyk{~orvxz}~}||{zyyzxuronc{YqF_@Y8M4I/A*<$2-#                                                 ~ ~~~~~}}}}{{zz{zy xvvwwwvvvvvttttr q q q o olll k k kiihggggg d d ` `_______ ^] \ \ [ Y Y W VUUTSRROPM$$W*2L.6P*H,>H*?H*?H,?F-@G0AG0AG0DI0DI/DK/DK1GL1GL1HJ1HJ1HJ1HJ1GL2HM3HO4IP7JQ7JQ9JQ:KR;LS;LSLT=KS;NU;NU9OT7MR㔥nqFiNVy^R{cMv^HqYDmU@iO>gM;fG8cD5a>4`=0`:/_9/\7-Z53Z30W00X/0X//W./W..V-.V-/V)/V).V%.V%.S+.S+-Q+-Q+,Q)+P(+Q&,R'/S(0T)3V&3V&/X$/X$/X$/X$-X$.Y%/Z&/Z&2['1Z&5X)4W(7X(8Y)8Y)9Z*8X*7W)3X)1V'/U$,R!+P!*O *M)L+K)I*I(G)F'D)D'B$>#=#;":":#;#='A%D'F)I*J+M+M(L)M(O(O(P'O&M%L'J&I(H(H+I+I-H-H,G*E)D)D'D'D%D%D"C!BAA?=;;!;"<"<"<::8877777777555543001011000//.////.-,,,++*+,****)(&&&%%&%#!!        "##$$% '$(%(%(%'&'&'&(')(*))+*,"+/#,0$-1&/3(15(15'18(29*4;*4;+5<+5<,7;-8H-?I+@I+@I+@G-BI0DI0DI/EJ/EJ0FK1GL2HM2HM5FL6GM6GM7HN3IN3IN3HO4IP9IS:JT7LU7LU8MT9NU>OV>OVAOWAOWAOYAOY@NV@NV=QV=QV;QV9OT߈hykEhMVy^R{cLu]HqYDmU@jN=gK:eF8cD6bA4`?2_:1^9/\7.[63Z31X10Y,/X+1X+0W*0V+/U*/U*.T).U(.U(0S+0S+0S+/R*,R'+Q&+R%,S&/S'0T(1V'1V'/V'/V'/X$/X$/X$1Z&0W(2Y*3X)3X)4W(3V'6X%6X%7Y&7Y&7X(7X(4V*3U)1T%.Q"/O!-M+L+L*J)I'G%E%D$C$@">#;":#;#;!<%@%D(G*I+J,K.M,N,N,N,N*N*N)N)N+N)L(K'J*I*I*H*H+I+I)G'E'D'D$C$C#E"D"C!BAA>=!;!;!;"<";";!:!:!9 8 876666543332210/00////1/..//..---,,,,,,,*)**((%&%%%&% " ! !       !"$&'( &#(%'&'&'&'&'&'&''((!',#).#,0#,0$-1&/3%04&15%26&37'4:(5;)6<*7=+8<+8<0;?1<@0=C1>D3@F5BH6CG8EI9FJ;HL=JP>KQ@LTCOWDRZFT\EV]HY`JZdL\fN`jRdnVjo]qvbwyez|m}qtvx{}}|yxxxxwofvTdO_?O3`;3`;1^9/\7-Z51Y50X41Y./W,.X(-W'-W'-W'-U*-U*,U(,U(/T,.S+0R,/Q+.Q).Q)-Q&.R'/S(0T)1V'1V'/W&/W&/X$/X$2Y%2Y%3Y(4Z)6X,5W+5X)3V'3W$4X%6X%6X%5W$5W$4V#3U"3R"1P 1L!0K -I ,H*I(G&F$D"B @"=!<!:!: ;#>A"D#H %J"(L (L ,N,N-O-O+N*M*N)M,O+N+M*L+J*I+I)G)G)G)G*H)F'D&C%B"E#F"D"D!B A @><<!;!;#;$<!;!;!:!:;;86655554344321//00///0/0.../00//.-+++*+*+*))'&%&('&&% # " " " !!"       #%%''('$'$'&'&'&'&(&(&)'*("),$+.#--#--%//&00%21&32#45$56%58'7:(8;)9<*:=+;>-=@.>A1>D2?E3@D5BF9EG9EG;GI=IK>IM@KOBLSEOVDQWGTZGV\JY_K\bM^dQcfUgjZlo^psfvyiy|p{tvz|~||yxvvusqjyTfM_8S3N'E"@73-+&!                                                       ~ ~ ~ ~}}}}}}{{{{zzyyxxyxxxvvut q q p o p o m mmmmml k i iiiihgge d c c a ` ` aa` \ \ \ \ \ [[[ Y YYYWWVU Q PKQ(N&1W*9L+:M+H.>H,@E-AF-BD-BD+AF,BG-BI-BI-BK.CL/CN/CN/DM0EN1FM2GN4GN4GN9HN:IO;JP;JP5KP5KP5KP5KP8KR9LS;MW;MW:OX;PY;QV*E/@G1CF1CF5EH5EH7GJ9IL;IQV9Q.I(C'G,>H,>H,>H,>H-?I-?I,AJ-BK-BK.CL/DM0EN0EL1FM4GN5HO3IN3IN5IN7KP9JP9JP;KN;KNLV=MW>NX>OV>OV?OY?OYBPZAOYAOWAOWBRUDTWASV@RUARYARY䔥m~wFhVUweR{cNw_IsWDnR?iM<< < <;;"<!;!< ;!;!;!9!9!75546655545432100021///0///////..,,,+*****))('%%&& $ $$# ! !  ! !""       !#%'((")#)%)%(&(&)&)&*)+*!*-"+.!-/!-/ .0!/1!23#45#45$56&78'89(8;*:=+;>-=@-D0?E1@F3BH4DG5EH9FJ:GKLTAOWCQYGU]HW]JY_M\bO^dSbhXgm\kqapvfvyiy|m}ptxz~|{yxwxwwyr]pTg@Y:S/J)D*:$4$/#.!+'#                                                } }}}}}}}}}{{{{zzyyvvvvvvvvut q q p o o ommlll k k kiiiihge d c b ab c b _ ___] \ \ \ \ [ Z Z W W W WVVR P K KFN"0M'5R)=H)=H*?H*?H+=G+=G+=H,>I,>I,>I,>I-?J+@I,AJ.BG.BG0AH1BI2BL3CM4DN5EO7GQ7GQ6IP6IP8IP8IP;IQ;IQ;JP;JP=JP>KQLT>LT>LT@NV@NVAOWBQWAPVAQTAQTAQTBRUBQWCRXCQYCQY㓥owMnYYzeT}eNw_IrXEnT;iN9gL6eH4cF4c?2a=2^;0\91\71\72[41Z31[20Z1,X/*V-)U,)U,-T--T-3S-2R,1Q*1Q*,R',R',S&,S&.R'.R'0T)1U*-X&.Y'/Z&/Z&.Y'.Y'1W&1W&3W$4X%2Y$3Z%1Z&/X$/X$/X$0Y%/X$0V%.T#.Q"+N+K)I&H%G$E#D#C"B!B?< = :#="A'F#$I!'L$(N#)O$)P#)P#,O+N+N,O,O,O,P+O*N*N)M(L)L)L)L'J%G%G%F$E$E#D$D#C#C"B"C"C!A!A @?? @=<===<;::;!9!9!7565664466644311223110////0000...,,+********)(&&%%% $ $ # " ! !       "$%'(")#(%(%(&)'('('*)+*!*-#,/!-/#/1!/1#13"34#45#45%67%58'7:)9<*:=+;>,E5?F7AH9DH9DH;FJ=HL=JP?LRANTCPVDSYFU[GV\JY_LZbO]eSbhXgm]mpaqtfvyiy|l|ptxz}}}~}{zzzyz{r^qWjCZE+>E,?F+>E+=G+=G+=H+=H+=H,>I-?J-?J,AJ-BK,AH,AH0AG1BH5CK5CK5CM5CM7DP8EQ7FR9HT;IS;IS:HP;IQ=IQ=IQ>JR>JR=KS>LT>NQ>NQ>MS@OUAOWAOWAPVAPVAQTAQTAQTBRUBPXBPXDOZCNY㒥pwIkTVxaV~bPx\IsWCmQ@jN%A)E'I)K*N#+O$+O$+O$+P!+P!*Q)P*Q*Q*Q*Q,R,R*P*P(N'M)L(K(J'I%F%F&E&E&E%D&D%C%C$B$C$C$C#B$@#?">">==";!:!:!:"9"98 999:876655566553311112111000100/0...,**+++***)(&&&&'&$$$$ " !        !%( *"*")%*&('('')(*)++-!*."+/!,0#.2 03 03"25#36$47%58'7:)9<)9<*:=*:=+;>.:B/;C1=E2>F2AG4CI3EH4FI7FL9HN=HS?JUALWCNYCQYFT\HV^IW_LZbN\dRcjWhoYnp^su`wyd{}j{m~rvx{}~~}|||zyzrbs]nJ\EW=J6C1;,6'3%1,+(%                                                 ~ ~}}}}}}{{{{{{zzxxvvvvuuuvvvut q q m mmmmml k k kkkiigge d c b ` ` a ` a a ` `__] \ \ [ [ [ Y Y W W V UUU Q P LMI#)X&5N(7P)>E)>E->D.?E0>F0>F/=G/=G0=I0=I/>J0?K,AJ-BK-BI-BI-CH-CH.CJ.CJ1CN2DO4CO5DP:GS;HT;IQ;IQ;IQ;IQ;IQ;IQ;IQMS=LR=MP=MP>LT?MU@NX@NXAOYAOYAQTAQTAQTBRUBQWBQWBO[BO[噬ryLnWXzcS|dLu]GqUDnR?iM"=#> =!><<#:"9"9!88!:::978764555765432200322211000/.../,,++,*))(('&&'&&%%$###"!        #$&++)#*$(&(&)(*) **!++ ,.!-/,0!.2 03!14#36#36$56&78'89):;+8<+8<-:>-:>.;A/F2BE4DG3EH4FI8HK:JM=JP?LRCMUEOWCSVFVYGWZIY\LZbP^fTbjYgo\op`stexyh{|l}~prvz{~~~~}|zyyxvrfwZkI\BU8M1F+<'8"52/,(%                                                   ~ ~ ~ ~ } }{{{{zzyyvvvvvvuuuuvvuu s s m l klll k k i iiiiigge d c b ` a````__] \ \ \[ Z W WWWWWUUSS N L H IJ$+V*7J-:M->E->E.?E.?E.@C.@C0?E0?E1?G0>F/@G/@G.AH.AH.@J/AK-CH.DI/EJ/EJ0FK1GL5FL6GM9HN:IO;JP:IO:IO;JP9JP9JP:KQ;LR=MP=MPMS?NT?MW@NXAOYAOYAOWAOWAPVBQWBPXCQYBPXBPX坰w~Wua\zfX{fPs^LqWHmSAhN?fL:eF8cD6b?3_<6^:4\84[43Z33[22Z1/Z-.Y,1X)0W(0W*/V)-U*,T)+S*+S**R'*R',R',R'-S(-S(-S(-S(.T)/U*2V*3W+4Y*4Y*3X)2W(3V&3V&3V&3V&0W#1X$1W&2X'1W&1W&3U)1S'.O%,M#*K!(I&H$F#D"C @? =<"=#>$D)I*N",P$+Q&,R'+Q&)O$*P*P+R+R,R,R.Q.Q.P.P0O/N.M-L+K*J&I&I&H'I'I&H&G%F#E#E%D%D%D$C"B"B!B A?>>???>><<!: 9 9!::9988876776654432222212211100/...--.,,++))('(''''''&$$$ "  !"!     #%&*+*"+#*')&)(*)*,+-,.-/.1/2 03!14"34$56%67'89*8:+9;+9;,:<-:>.;?-D/>D1@F.CE0EG/FH0GI4IK5JL;IQ=KSBNVDPXCSVFVYEWZHZ]M\bQ`fUdjZio[pr_tvbwyg|~k}nrvxy|~}||{wwtsi{ZlJ_DY8M2G/>+:'6%40.)%                                                ~~}}{{{zzzyyyxvvvvvvuuuuuutt p pl kllll k k i iiiiiggfed c a a ` ```__] \ \ \ Y X V VVVUUSSR Q M L IJ"M"+V'9I);K+>E,?F->E.?F0?E1@F0?E0?E1?G1?G1?G1?G/@G0AH2@H3AI0DI0DI-FH.GI1HJ1HJ5FL6GM9HN9HN7HO7HO6IP7JQ8LQ8LQ8LQ9MR:LO:LO=MP=MP>MS?NT=NU>OVAOWAOWAOWAOWAOWAOWARYBSZCRXCRX栲wSr\XwaV}cNu[KrXFmSAjK>gH9eD8dC5a>3_<3^91\73Y53Y52Z11Y0.Y--X,/X+.W*-V)-V)+S(+S(*S&+T'*R'*R',R'-S(,Q)-R*-R*-R*1U*1U*2W(4Y*6Y*6Y*7W)7W)5V&5V&5W$4V#0W#1X$/X$0Y%/X$/X$-T'+R%)P#'N!#J#JFDDA?=!;"<#='A'F.M#*P%,R',R',R'*Q$)P#(Q)R)T)T+T+T-S,R.P-O-O,N*L*L+K)I%G%G%G&H$G#F$G"E%D%D'D'D$C%D"B!A @?>==>????>><;9:9898777656653221222222001210..---,--,,+*))()))*))($$$$ % #!  !!     "$(*+*"+#)&)&('*)*,+--..//2/2 03!14#36#36$56&78'89):;':;':;);>*D+?D,@E.CE0EG/FH0GI2HM4JO9JP;LR?MWAOYARXCTZEV\HY_M[cQ_gVdlZhp\nqasvcxzg|~i~mtvx{|~yywvtrj|^pNbI]=O8J6A1<+8'4 10*&"                                                          ~ ~ ~ ~   ~ ~ ~ ~~~~~{{{zzzzzyyvvvvvvuuuuuut soo kllll k i iiiiiiihihg d d a ` _ ___] \ \ \\[ Y XVVUVUURR O ONM IN'M!.T%;H'=J)>G)>G+=G+=G-=G-=G/=G/=G0=I1>J/?I.>H/?I/?I0AH1BI0CJ0CJ/DK/DK0EL0EL7EM7EM8EQ8EQ5GQ5GQ4IR5JS6LQ6LQ7KP8LQ:LO;MP;NO;NO1`<1\71\73Z32Y22Z10X/-Y0,X/+W.+W.)U,)U,&T,%S+'S*&R)*R)*R)+S*+S*+S*+S*+S*+S*1V'1V'3X)3X)6Y*5X)5W+5W+2X'2X'/X$/X$/X$/X$/X$/X$/W&-U$,P$+O#)M!&J"IDDC?><<!:";$@'C*K!-N$/P&0Q'.R&-Q%*Q")P!)Q )Q *S*S*T)S)R)R(P'O)L(K+J+J+I)G%F$E$F%G%G$F'F&E(D'C'C'C#D"C!@ ?=<;<<=!< ;=<=<;;99989986655565434333331100010/.,,--...+++***))))*) ' & "##$% # ! !         $(* * )#*$('('(*)++-+-,.-/ .0"02!23"34 34!45"56$78'89(9:)9<)9<+;>,A->D/@F0AG3DJ2FK2FK4HM6JO9JPJ.>H.>H.>H/?I0?K1@L.CL.CL.CJ/DK3CM3CM5BN7DP6EQ7FR3HQ3HQ4IP5JQ7JQ7JQ9IS9IS=KSLT>LT@NVAOYAOY@NXAOYAOYCQ[@R]@R]@R]@R]XwgRqaV|eSybKtZFoU=jK:gH7eD5cB6a<5`;8\85Y57Y37Y31Y.1Y..Y--X,,V-,V-*V.)U-(S.'R-)S*)S*+S*+S*-R*-R*,T++S*+S(+S(-V).W*1X)2Y*3X)3X)2W(2W(1Z&1Z&0Y%0Y%/X$/X$/W&/W&-S(,R'.O%-N$*K!'HEC@><<;;<"?'F*I*N",P$-Q&-Q&/P&/P&-R#+P!+P!,Q"*R!*R!*S)R)Q (P'N!&M &K%J)I)I'H&G&E&E%G$F$D$D$C$C%B%B#D#D C C@?>=<=<<";";!:";";";;;:9::9987545566333233322100000/.-,--.--+++***(())*)( ' $ $$$# " " !    $' *"*")&)&')')(,)- )-!*. +/!,0/2 03!14"25 34!45#67$78&9:':;':;)<=*D.?E/@F1BH3DJ6EK8GM9HN:IOH)>G)>G+=G+=G.?F.?F0>H0>H0=I0=I1?I1?I1?I2@J3AK3AK2CJ2CJ1DK1DK1DK1DK0EN1FO2GP2GP3HO4IP4KM5LN5JQ5JQ5JQ5JQ:KR;LS=KS=KS>LV>LV?MW@NX@NXAOY?OY?OY?OYAQ[BQ]BQ]DP_CO^»SvaNq\S|dQzbLt^FnX@iO5_<8\86Z65Y55Y52Z11Y0.X/-W.-V/,U.*U0)T/)T/(S.+S*,T++S(,T).T)-S(-S(-S(-R*.S+1T,2U-3W+4X,4X,3W+1X+2Y,3Z+2Y*1Y(0X'0X'/W&/V)-T',R'+Q&-N$+L")J &GEC?=<<;=#@(E"'J")L$+O#+O#0P$0P$0Q!1R"/R".Q!,R!,R!-S",R!+R+R*N#)M"*K!)J )I)I(J'I(G&E%E%E$G#F#D$E#C#C#C#C#C"B"B"B!A @ @?>=== < < < <";"; ; ;::::::8755555411222222000000/..-,-,,,,,,+*))**)((''''' % $ # # " !   !&)!)#*$(')(')(*)-)-!)0!)0!,0"-1!.2"/3!14"25!36"47#58%7:)9<)9<)9<+;>-=@.>A.F1?G5CK6DL7GJ8HK9IL;KN=JN@MQBNVCOWCQYFT\HV^M[cQ`fTci\imanrbrufvyk{~n~rstvx{}}}}}~~}|{zxvtp}_pRcFVAQ6G1B);$6!2!2,+'$                                    ~ ~}}}}{{{{{{}}{zzzzzxxvvvvvvuuuutt p pmml k i iiiiiiiiiiihgd c a ` _ ___] \ \ [\[[ Z W WWVSSP NM LKKH%T"3N&7R)=H)=H)=H)=H+=G,>H.>H-=G0=I0=I1>J2?K0AG0AG1BH2CI3AI3AI4BJ5CK3DK3DK2EL2EL1FM1FM2GN3HO3IN5KP5KP5KP5JQ5JQ5JQ5JQ;LS;LS=KS=KS>LT?MU>OV?PW=OY=OY=OZ=OZ>P[@R]DQ]DQ]CP\CP\ƾTzdMs]Ox`R{cLt^GoY?gQ=eO9dE7bC5a>3_<7\<5Z:3Y53Y51Y00X//W..V-+U,+U,+U,+U,+U,)S*+S(+S(.T).T).T)-S(.Q).Q)0P)2R+3S,4T-5V,6W-4X,4X,2Y,1X+2Z)0X'0X'/W&/X$/X$-T%,S$+R#)P!.N",L )I&FEC?><=<#A#E'I#*N#+O$-P!-P!/Q/Q/Q0R.Q!/R".Q".Q"-P -P -Q+O-N+L+K*J)K(J)H(G'F&E#F#F#F#F#E#E#D"C C C!D!D"C!B!CA @ @>=>>== < < : : :9::99!9 8"7 555665544223232110100/0.---+++,+***+*--* )'(((' && $ % % # " !!         !    #&)!)#*$+(+((*(**,+-"+/"+/#,0$-1$-1&/3#04$15!36"47#58%7:*7;+8<+8<-:>-=@-=@/=E/=E0>F2@H5DJ6EK8IJ8IJ:KL;LM>KOANRBOUCPVDRZGU]JX`N\dTagXek_jndosfswivzn{q~tvuwy|~~}}~}~||zywsguYgKZET:I5D,<)9!4 3.,'$!                                                   ~ ~ } }}}}}}}{{{{{zzzyyyy v vvvuuuut s q qr q p p m ml k k kkkiihggggge d c b _ _ \ \]]] [ Z YZ Y Y YWWWVSSN L I I IJM'V$3L(7P)=H)=H)>G)>G*?H*?H+=G+=G.>H/?I2@H4BJ2DG1CF1BH1BH1BI1BI4BL5CM5CM5CM3DK4EL1FM1FM2HM3IN4JO5KP5KP5KP5JQ5JQ7JQ8KR:KQ;LR;MPMS?NT?MU@NV?NZ?NZ;OZ;OZ=Q\=Q\CP\CP\CP\BO[·U{eNt^Q|dP{cLt^FnXAjP=fL;eB9c@7b=6a<6^:3[72Z60X40W00W0/W.-U,-U*,T)+V**U)*U))T(+S(+S(.U(.U(.U(,S&+Q&,R'.S+/T,.V+.V+.V+0X-/W,/W,1X)1X)1Z&/X$/X$/X$.W#-V"*Q"*Q"+P!+P!-M!*J(H&F"D B@ ? ;<"A&E(L!+O$,Q"+P!+R+R-R-R-R-R-P!.Q".P$.P$/O#.N",L,L(K(K'J'J+J*I(G'F$F#E#E#E#D#D%D%D%D$C%C%C#C#C"C!B#B"A"A"A @?==<<<<=<;;:::9 8 8!6 5767766552233333222232211...-,+,+*+**,-+ * )*)((( & & & &$$#!    !   !""      $')!)#+%*)*))+)+)-*. ,.!-/#,/$-0#/1$02!23#4545 56$78%89(8;)9<)9<+;>+;>/?B/?B1AD2BE3CF5EH6FI5GJ7IL8JM9KN;LROV@QXES[IW_LZbN\dSaiVdl]mp`psevwj{|l}~prtvxz}~}}|}~~~}yyutjz\lP[ITBJ;C6=3:*7(5$3. *'$"                                                      ~ ~ ~ ~ ~ ~}}{{{{}}{{{zzz xyyyyyvvvvuutt q q p pq p p p m ml k k kiihggghgeed c ` `_ ^]]]] \ [ Y Y W W W WWWUUR QM L H H IM#M .X#;H%=J(@F(@F)?D*@E*?F*?F,>H+=G,>H-?I/BI/BI4DG3CF4CI4CI3AI3AI4BL4BL3BN3BN/DM0EN1GL1GL5IN6JO9JP8IO5KP5KP5JS5JS6KT6KT8KR9LS9LS:MT:MT:MT;MWP[;PY<<==??>=<;99887677778764333322321222320/.-,,,,,++***++* )*)''' & % $ % $ # #!! #$#"   $'*+!,"*'+(*)*)+*,+ -+ -+#--#--#0/$10$24%35#43$54(76)87+9;+9;*;<+<=->?.?@/?B1AD2BE4DG5EH6FI8IJ9JK7KP8LQ7LU:OX;PW>SZCW\EY^L[aP_eTciZio^nqbrugwzjz}m}pswxy}~}|~~~~}|yyutl|brP_JY;K5E1@-<)8&5!1.+('%!                                             ~ ~~~~~}}{{{{}}{{zz x xvvvvvvvvvvvvtt q p m mppq p p o m ml k k kiihgee c c c c a ` _ ___] \ \ Z Y Z Y Y W VUUSS O OM L I J GM*N#1U'=H(>I*@E+AF*AC*AC+AF+AF,?F-@G-?I-?I0AH1BI3BH2AG3AI4BJ3AI3AI3AI4BJ3DK3DK/EJ0FK2GI4IK9IL:JM:IO;JP9JP9JP8IO9JP:KR:KR9LS9LS9LS:MT:MT:MT=NU?PW=OZ>P[=PW>QX?QT@RUCSVBRUCRXCRX㳽~SjYJsYR{aIv_DqZ>kS;hP6fF3cC3b>1`<1]:/[8/Z5-X3*Y/(W-(W-(W-)V*(U)+S(*R',R',R',Q),Q),Q),Q)*R)*R)+S*+S*,T)-U*.W*.W*0W*0W*/U*/U*0V+/U*/W&/W&0W#/V"-S"-S".P$-O#+N*M)I(H%F#D!CA==!A$D(G+J .M#/N$/O!/O!+Q +Q 'R(S(S(S)R%(Q$)O$)O$*N#'K )J(I'I'I(J'I%F%F%E%E$D$D$E$E$D$D#D#D#E#E#D#D"C"C#B#B"A"A!A!A!A @ ?><<<<!=!=!=!=!;!; 9877778776875334454332222232//,,,,,+++******)))((( & & # # " "# "   "##" "'*+!,"*'*')(+*,+,+",,#--$..%//%.1'03&24'35%26'48)6:*7;+8<,9=+<=->?/@A/@A/?B1AD3CF3CF5EH6FI8HK:JM9JP:KQ9NW:OXLT?MU@NXAOYANZANZAOWAOWAPVBQWBRUBRUBQWBQW„\rcIq[RzdKxaEr[?kP=iN8fE6dC3b>1`<1]<.Z9/Z5-X3)W/(V.'U-'U-'U-&T,)S*)S*+S**R)*R)*R)+S(+S(+S*+S*,T+,T+-U*-U*0V+/U*0V+/U*/U*/U*/V)/V)1X$1X$1X#/V!-T -T +P!+P!*M(K)K&H$E"C?=<?!B%F$J&L!*N"*N"+Q +Q 'R 'R (S!(S!'U 'U %T#$S"'O$&N#'N!$K(J'I&H'I$H$H!G!G!F E#F#F#F#F#F"E!D!D!E D CB!C B BA@ A!A!AA@>>;<<<=<<<;:9998888767874334454332231010/. ,,++*)**++,***))))('$# " !!""""" !"#$%% !  %)!*$,&+(*'*(*( **",,",,#--$-0%.1&/3'04&15'26$47%58'7:)9<)9<*:=+;>-=@.>A/?B0@C1AD3CF4DG5FG8IJ9JK;LM:KQOV?PW@SZCV]EY^I]bLacPegXio\ms_pvdu{hyj{nryz|}~~}{{zzzzyxuvqj}\mRcDV=O4H1E.=+:)3'1$,!)(%!                                         ~ ~ } }}}}}}}}}}}}}{zzzy xyxvvvvuvvvvutt q q p p p pq p m llll k k kiigge d ` ``a`` ^_] \] \ [ [ Y Y W V V USSR Q N L I I IJH%T%4M(7P*?H*?H*?F+@G*@E*@E*?F*?F+@G*?F,>I,>I1>J1>J4AG5BH4CI4CI4BJ4BJ4BJ4BJ0CJ1DK/DK/DK4EL5FM9GO9GO:HP;IQ;IQ;IQ;IQ;IQ;IS;IS=>AI!K"M!#N"&O"'P#'R'R&T&T&T'U 'T"'T")S#'Q!'O$&N#'N!#J%L$K#J"I$H$H!G!G!E!E#E#E#F"E EDDDDDCCCBAAAB!B!B@??=<>==;;;:::99<;::99776654345643332311//.-+++***+,++ + ****+))'& $ # " " "#"" ! ! !! $%%'#    !&*+%,&+(*'*(*("**#++!.-"/.#0.$1/%04&15'18(29$47%58'7:)9<*:=*:=+:@-OP@PSBRUETZGV\G[`I]bNdbRhfXlj^rpctugxyk{~n~qu{}~||yxxxxwxxwyyq`rXjDZ>T3J/F+A'=&5#2!.+)'$                                            ~ ~ ~ ~~~}}}}}}}}{{{{{zy xxxvvuutttt q q p p p o p pqpo n kl k k i ihggggg d d ` `] \ \ \]] \ [ [ [ Y Y W W U URRP O L L H HHJJ#*U)8K+:M*>I+?J)@I(?H(@F(@F(@F(@F*?F*?F,?F-@G1@F2AG2BE3CF4DG4DG4DG4DG2CI2CI/EJ/EJ0FK0FK2FK3GL7IL8JM:JM:JM;JP;JP;IQ:HP;IS;IS9JP9JP8LQ9MR:MT:MT>?>=;;::::;:::877777565555331111100 /-,*****+,,++****))('&& $ $ # ##$## " "  "#$%%%#    "'++#-%+(*')'*(+) -+.-/.01!23!14"25#36$47#67$78$9:%:;(:=);>):@+NQ?ORAQTCSVDU[FW]F]_JacNfdRjhVnnZrrbwyez|j|mqtyz|~~~~~}}|||{zzzzuqbv[oM^GX9M6J.D*@&8#5"3.*)$!                                              ~ ~ ~ ~ ~ ~ ~ ~ } }}}}}{{{{{{zzy xvvvvuuttr q p p p p p p p pq p m l kl k k i ihggge d b b`` ^ ^ \ \] \ \ [ Y YZ Y W V S SPP N M K K H IGK(M'0U-;J.= @#C$F'I$L&N)R)R(S!(S!&S!'T"%T"&U#'V$'V$(T$&R")P#'N!*M)L'J'J%I%I'I%G%G%G#G"F E E D D"D"D!D!D#C#CDDDDDCCCBBBA?>==>??>=<::::;::9999976667777443221102221.,++++,,,-,,**))((('&&%% $ # # #### " ! ! "##$#$!     #),-".#+(+(*)+*,+.-.-/. 12!23"34#45$47&69"79#8:&8;'9<(9?):@*;A->D-?B/AD/AD1CF1DK2EL3FM5HO7KP8LQ=OR?QT@RUCUXCW\EY^G]bLbgOfhTkmYpr]tvcxzf{}m}pruz{}~~~~}||{zzzwwsqh{buQbJ[>Q:M/E*@(:$6"3.*'$#!!                                  ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ } }{{{{{{{{zzy xvvvvvvvut s p o o ooo p p p p p o l l k kiiiig f dee d b b ^_] \ \ \ \ \ [ [Z Y W W W WUU O OMM I IFFEM$0M*6S,>I-?J.>H/?I-?I-?I+@G+@G+@G,AH,BG,BG,CE,CE.CE.CE1CF2DG2EF3FG2EF3FG2DG3EH3DJ3DJ2FK2FK3FM3FM4GN4GN6GN7HO8IP8IP7JQ7JQ7JQ7JQ5JQ5JQ6KT7LU7LS7LS;LS>=<;:::;;;;;::::977767754332222002210.---,,,--,++))''&'((((%%% # $ $##"!   "" !"!##!   $(,,%,%,(-)+*-,.-.- .0!/1#13#13%35&46$56%67#8:#8:$9;%:<(9?*;A)=B+?D,AC-BD,CE.EG/EJ1GL3IN5KP8MO9NP>PS@RUBSYEV\DW^GZaH]dMbiRikVmoZqs_vxez|h}n~quxz|~~}||zzyywvsrid{PhH`;S6N/E+A(:%7!40+'$#                                       ~ ~ ~ ~~~}}}}}}{{{{{{zzzzyxvvvvvvvvut q q p p m mmnppoo k kiiiiiiggeee d b b________ \ [Z Y W W U US R N MM L I HIIF#%S*3K/8P-?I,>H.?F/@G/@G.?F,>H,>H.>H.>H/?I/?I2AG1@F1AD2BE3CF4DG2DG2DG.EG/FH.EG.EG1FH1FH1FH1FH4EK5FL5EO5EO6FP7GQ6JO7KP5KP5KP5KP5KP5KP5KP9LS9LS9KU9KU;KU3_<0\9/\7.[6-[3,Z2,X0+W/)T/(S.*R.+S/+S/+S/+U,+U,-U,,T+,T),T))T()T((S'(S'+S(-U*/U*0V+2Y,2Y,0W*/V).U(,S&,S$)P!(Q&O$K#J#F C"?< ="?&F)I,M-N.P/Q-P /R"*U#*U#&V!$T'U 'U *R!*R!+P!+P!,M#*K!(J'I&J&J$J#I!H!H G G G GEEEE!D!D#E#EDECCBBCBAAABBA@????><;::<<<;::;:888877777743212222112210/.-,+,,-,,+**)(''(&&& %%% $ # $ $ % # ! !!     !#$#    #')!*&-),),),+-,-/-/#/1$02%04&15'26(37'48(59$69&8;%:<&;=':A)E,@E/CH0EF1FG5FL5FL7HN9JP8LQ;OT=QV?SXETZGV\HY_K\bIbdOhjRkmWpr_tvbwyhz}k}psuwxz}~}|{zyxwwwyxutpm~YnPeAT>Q7D3@/;+7&5#2,*$#                                       ~ ~}}}}}}}}{{{{{{{{zzyyvvvvvvvvvvt s p p p o m mmnnnmm k kiiiiiigge d c c ` `______] \ \ [Z Y W WUUR Q M NM L JKKKI&(T-8K/:M0>H0>H0>H0>H/?I/?I/?I.>H.=I/>J1>J1>J1?G1?G0?E1@F2AG3BH1BH1BH0DI0DI0EG0EG0EG1FH2CI3DJ6DL6DL8FP8FP6FP7GQ3HO4IP5JQ5JQ9JQ9JQ;IQ;IQP[=OZܑOxf4]K8nVBx`>rZ:nV7kM3gI3fD0cA/`<._;.]9,[7-[3,Z2*X0(V.'T/'T/'T/'T/)U-)U-)U,)U,+V*+V*+V*+V*'V*&U)'V,&U++U,+U,.V-.V-0W*0W*/V)-T',S$*Q"+R*Q)M'K&H$F#@#@ =!>!A%E$I!'L$+O$+O$,O-P *S+T 'W"(X#&X#%W"'T"&S!+Q *P+O*N*N)M'K'K&J%I$G%H"G#H"F"F FE!E!E!D!D#E"D#E"DCDCBAAAAAABCCBAA@@??<<;;;;;;::9887778877775532223212000/....--,--,,+)))(((&&% $%%% # $ $$ #!! !  !! "" $&&&    "&)"*'+(,),),+-,!.-"/.#0/#0/&00(22'43(54'57(68&8;'9<'9<(:=):A*;B.SUAVXGWZIY\M\bP_eNegSjlXoq[rtavxdy{l|n~rtxz{}}~}}zyxxvuwwyxvurqbvWkFX@R4F0B+=(:$5 1-*%#!!                                       ~ } } } }}}}}}}{{{{{{{z xyvvvvvvvvuuttr q q q q q p o m mnnmm k kiiiiiiggeed c c c ` `_ ^ \ \ \ [ Y Y V UUUUUR QN L J JKKLO #M,/Y/9F1;H1H0>H0>F1?G-@G-@G.@J-?I/?I/?I0>F1?G1AD2BE2AG2AG2@H3AI3BH3BH3BH3BH1BH2CI3EH3EH5EH7GJ7FL7FL4GN4GN3JL4KM5LN5LN9KN9KN;KN;KN;KN;KN:KR;LS;KU;KU=MW>NX>NX>NX?OY?OY=OY=OY=OY=OY㛫W}l3YH6pSA{^@uY;pT:lL6hH5fB3d@1`<0_;.]9-\8+[3*Z2+Z0*Y/*V.*V.)U-)U-+T-+T--U*-U*-W'-W'-W'-W''W)'W)'V*'V*(W+(W+,W*-X+-W'-W',V&*T$*R!)Q ,O*M(K&I$F"D A@@!BG"J%M"'O$)O$)O$(Q)R)T +V"'Y$(Z%'Y&'Y&(T$&R"+P!)N,N,N+N*M'L'L%L$K H H G GFF FEEDB C D D!E!EEECB@?ABAAABBAAA@A@>::;;<<<<:::9777888777755443332111100//00.--,,,,,**))(('&%%% $ $ # # # # #!!"#!"!  ! $ $%&'&    $( +#,&-'-*.+-,.--/ .0#/1$02%20'42'43)65(68)79)9<)9<*:=,E/@F1BH3DJ4EK4HM6JO5KP7MR9PR;RTU2G.C'=%;"63 -,'%##                                               ~ ~ } } } }}}}}}}{{{{{zzz x xvvvvvvuutt s s s s q q p p m mmmmml k i iiiiiggeeeed c c c ` `_ ^ [ ZZ Y W WWWUUSSP NM L J JKKLS,L&3S-H0>H,?F-@G+AF+AF+AF+AF-@G-@G/@G/@G-AF.BG.BG/CH1BH2CI2CI2CI2CI2CI1EJ1EJ1FH1FH2GI2GI5FL5FL6GM6GM0IK1JL3LN3LN7KP7KP9JP9JP9JP9JP:KR:KR:KR;LSNX?OY=PW=PW;QV;QV譻m>aS:oUDy_?uW?!A%E"J!&N%'O&(P')O$)O$)P!*Q")V$+X&)W)+Y++Y+)W)+U%'Q!*O (M*M)L*K*K'J'J$I#H!H GFF F F!FD!D C"D"D"D"D#E#EEEB@@@? @ A A B B BAAA@@??;:::<<<;<;:877888887777665433322220/./..-,,,+,,,***)))((('& % # ## ""! !#""#!  "$$%&&%   #("+%,),),-./.-.--/!/1#/1%13'35'35(54*76'89(9:):;):;(:=);>,=C,=C->E.?F2BE4DG5EH7GJ8JM9KN6MO9PR;RTUWAXZF[]I^`MbdPegTijYno]rsavwhx{l|orsvxy{|~}|{{yxxvvuvvwvogwOcBV3I1G+@)>%7#5#.!,(&$#                                                 ~ ~ } }}}}}}}}}{{{{{zzzxxxxvvvvuuttr q qr p p n m m mmmmml k k kiiiihgeeeeee c c ` _ \ [ Y Y W W V UVUUUSS O M L L LMNMM%V3K#7O'>G'>G-=G.>H.>H/?I-@G-@G,BG,BG+AF+AF+@I+@I+@G+@G+AF,BG-CH-CH1BH1BH2CI2CI3DK2CJ/DM/DM1DK1DK2EL2EL5FM5FM5GJ6HK4IK5JL5IN5IN6IP6IP6IP6IP4IP5JQ7JQ8KRrZEu\AqXAnQ;hK8eF5bC5a@3_>2^;0\9.[6,Y4,Y4*W2+V1+V1,U.,U.-U,-U,-V),U(-V)-V)+V*+V*+V)+V)+V)+V)-V)-V)-W',V&-T%,S$,S$*Q")O$'M"'K &J%F#D"C AAA E#H 'M")O$)P#*Q$+P!,Q"-S"-S"-U$.V%-V)/X+.V+-U*+Q&)O$)M!'K*J*J*J)I%I%I"H"H"H!GFE"F"F"E!D!C B"D"D"D"D"D#E#C#C CAAA A!B!A @ @ @ @ @>>>@?@==<<<;;;::::999999886677655433332210/-..,,+,++,+**))*)*)''% $# "#"!!   !""  !##$%&&&  &)#+%,),)-../-/ .0!/1!/1"02$24'26(37(46*68&76(98):9):9*:=,D0?E1@F6CI7DJ8EI;HL8JM:LO:OQG)>G-=G.>H.>H.>H,>H-?I,AJ,AJ+@I,AJ+@I+@I+@I*?H+?J+?J.@K.@K2?K4AM4CI4CI0CJ0CJ1CN1CN3BN3BN6DL6DL7EM7EM7EM7EM8GM8GM8FN9GO5GR6HS6HR6HR6IP7JQ7JQ8KRPS>PSޓTrm$ZI4jY>v`;s]@mU:gO8eF6cD5a>3_<5`;3^90\4/[3+Y1*X0)W/)W//W.-U,-U,-U,-V)-V)+W'+W''W)'W))V*)V*-U*-U*/V).U(0T(.R&-Q&-Q&,P%+O$%M"#K "J!I FCAAA"D%H (K#(N#)O$)P#*Q$)P!*Q"+R#,S$.U&/V'/V)/V)/U*,R')N&'L$%K $J%J%J'J'J'I&H&G&G!F EFEF G#G!E#D"C"D"D"D!C!C"D"B#C"B!A!C!C!C!C!A!A#A"@"?"?=<<<?>??>==<=<<<:;999998877666544334444421/..---,+,,****)*)()(&&$$$$# " " ! ! !!!!   !"$$%%%%#(%+(,*,*,/-0 .0!/1 12 12 12"34'35(46)57*68+79,8:):;+<=*A0@C4AG6CI7DJ9FL9IL;KN;MP=OR>PS?QTARXDU[DW^GZaG]bJ`eNdiTjoXoq]tvaxzd{}l|orsvxz|~~~zzzz{{yxuuuttwgyWiAU:N1E,@*;'8%4$3/.)'$!                                         ~ } }}}}}}}{{{z{z{{zzyyvvvvvvvu sttt q q o pnmmmmm kllll k i iiiiiiihgee c c c c ` _ \ [ Y Y Y Y W VVVUU Q PM K IKNN LQ(P#0X%:I&;J)=H*>I,>I,>I-?J,>I+@G,AH-BI-BI,AJ,AJ+@I+@I+?J+?J*>I+?J-?J-?J1@L2AM2CI3DJ2DG3EH3DK2CJ5CK5CK6DL6DL7EO7EO7EM8FN:GM;HN9GQ:HR6HR6HR6HR7IS9IS9ISLT?MW?MW@NX@NX?PW?PW=<:;>????>><<<;;::::8898877665554433433321/.//,,,,,++*))(()(''% $ % % $ $%$ " "  !     !"$$$$%$  $+#.&.*.*././0101 12 12 12"34'43)65+87+87(9:):;(:=*D0AG3BH5DJ7FL9HN5KP7MR9NU;PW=PW?RYAT[CV]DY`F[bI^eNcjRikVmo[rt`wyf{}h}m}psvxy|~~|||||{zyxxxwuvj~^rI`>U4I/D+=(:'7%53/*($                                                    ~ ~ ~ ~ ~ ~   ~ ~ } }}}}}}}{{zzzz{zyyxxvvvvvvut stttr q p o o pmmmml k k kllkkiiiiiig f c cbcaa_ ^[ Z YZZZ Y XSSRR L K I IKLNNIR"0M&4Q(;I)H-?I,>H-?I.@J.@J.@J/BI/BI3AI3AI3BH4CI1EJ1EJ1DK1DK3DJ3DJ7EM7EM8FN8FN8FN9GO7FR8GS4HS4HS5IT5IT9HT9HTLT=NU=NU>NX=MW@NXAOY?OY?OY;PW;PW۔:hbLF0hR8pZ=pT7jN5fI3dG3cC1aA2^;1]:,\4+[3*Z2*Z2+Z0+Z0.X/-W.,W++V*)X')X')X')X')V*)V*)V*)V*-V),U(-T',S&+Q&*P%)O$)O$&N#$L!"J!I FEAAA#E$I!(M%+N&,O',P%,P%%Q!&R"$S"$S"&U$&U$'V%'V%,S&+R%*Q$(O"%M"$L!#K"!I #I"H"I#J%H %H %G!#E FDEE D!E"F"F!D!D!D C C CABBAA@?@A B B B!A @>>;:::<=?@@?=;;;;;::::98887766665522223333330/.-,+,,,,,*''''''((&& % % $ #$$ " " ! !   !"#$$%%$  &!+#.&.*/+-0-0.1/2 03!14!23#45%43'65(68*8:)9<*:=):@+D/@F1BH3DJ5FL5JL7LN6LQ8NS:OVN7G/@+<'8&741-+$!                                    ~ ~~~~~~~~~}}{{{{{{{{{z{{zzyywvvvvvvvuttt stttr q m mmmmml k k kkkiihggghhg f ` `____ \ [Z Y WXZZ Y XSS O N K K JKNOO NK&T4J"7M(=F)>G-J+@I+@I+@G,AH,AH-BI/BI.AH-@G-@G-?I.@J.AH.AH-CH-CH/BI.AH2@J2@J3AK4BL.CJ.CJ/EJ/EJ1DK1DK6DN7EO8FN8FN4GN4GN5GR5GR6HS6HS7IS7IS9JQ9JQLT?MU@NV?MU?MU@NXAOY?OY?OY;OZ;OZPNLWF*iX=qS9mO?@@@@@?>>=<;;=>?@A@?><<;;::88777766444443333333331110//,+,--,**''''()))&&&$ $ ##"!"!     "#$%%%%%$  #)#-&.'/+/+-0-0/2 03!23!23"34#45$56&78(9:):;'8>):@&;B'E+@G0EG1FH3HJ4IK4KM6MO7MR:PU@QXBSZDU\EV]FW]J[aK]`OadSdjVgmZoq]rtavxez|j|mrtvxy|}~~|||{|zxwxwxwtso~rctPaHTAM9C3=.;,9%6#4 1.+'#                                       ~ ~~~~~~~}}}}{{{{{{{{{zz{{zyyvvvvvvvvttr q qrrr q q m mmmlll k k kkkiihggggge c _ ___] \ \ [ Z Y WXZ Y W VSS O M I JKLOOOQ$I0U";E$=G*=D+>E0=I0=I0=I0=I,>H-?I,AH,AH-BI-BI1BI0AH1?G1?G.AH/BI.BG/CH/CH/CH0AH0AH0AH1BI2BL3CM0CJ0CJ0CJ0CJ0BL1CM3BN4CO5FM6GN4GN4GN4IR4IR4HS4HS6HR7IS;IS;IS:JT;KU;LShL:dH7bC5`A5^?3\=1[8/Y61Z30Y22Z11Y00X//W.,V-+U,)U,(T+)V*)V*(U)'T(+T'*S&*U!)T *Q"*Q")O$)O$'N!%L#L"K"I!H!B!B!B$E"!I%%M)%Q(&R),R',R'+R%+R%(R"(R"'T"'T"'T"'T"*U#)T"+R%*Q$)O$(N#(M%'L$(J$&H"%I%I'H'H(G(G'G&F#E!C BAB!D!D"E"C!B!C B!D!D!D!DDCBBABBBAAA@?>>=;;=>AABA?=<;;;;:8888 9 976445655222200222210//--+*,+,+**('))))()& $ ! !!!! !  !#$%###%%$ $*#-)/+.,/-.//0 03!14#36#36$47%58&69'7:)9<+;>+C*@E,CE.EG/FH1HJ5IN7KP6KR8MT:OVI-@G.AH/BI.AH0AH0AH0AH1BI.AH.AH.AH/BI/BI/BI.@J/AK0@J1AK2CJ2CJ1CM1CM0CJ1DK1DK1DK2DN2DN4FP4FP5IN5IN5HO6IP6HR6HR8IP9JQ;IQ;IQ:KR;LS9LS:MT>LT?MUCMUCMUCLWENYBMXBMXAOYAOYsMFG@,eK5nT7jN4gK7dE3`A3_>2^=2\90Z73Z33Z32Z11Y01Y0/W.,V-+U,)V*)V*'V*'V*'V*&U))T'(S&+S"*R!+P!+P!(N#(N#%L#J"K I"F!E"C"CG"J!%O&&P'*R'*R'-Q%-Q%-R#-R#+R#+R#,S$,S$-U$-U$-T%-T%)Q&(P%'O$&N#(N#&L!'K %I'I'I)G )G 'F'F&F&F%E#C#C!AB!DCCCC!D!D!E!EFFFFDDBBBBBBAA@?=<;;<>?@@?>=><<<;;999;!:!:876566432211002232210/--++)*++**))()***)& %$###!!!!!!!""$$%$$$%'%  &,%-,.-.//001 12"34#45%35&46'48(59)6:+8<*9?-A-?B,AC.CE0EG1FH3HJ6KM9JP9JP:NSH0>H0>F1?G1?G1?G/@G0AH0AH1BI1BI1BI/BI0CJ.CJ-BI/AK/AK0BL/AK1@L1@L4BL4BL2CJ2CJ1DK1DK/EJ/EJ0EL0EL0EN1FO4FQ4FQ6GN7HO8IO8IO8GS8GS9JQ9JQ;JPLVBKVCLWCLWDMXBMXBMX@NV@NVߣDxtQMYG+o]4mT/hO7eD4bA3_<3_<3^91\72[41Z33[22Z12Z10X/*V-*V-(W+'V*'W)'W))V*)V*+U%*T$*S)R*O )N+M!+M!&J$H IHFGE G!J%N!*P%+Q&-Q%,P$+P!+P!-R#-R#,S$,S$/U$/U$1X$1X$-X&+V$(P%'O$&N#%M"'N!%L$L#K"I"I!G!G#G"F#G$H#F!D!DBB C!D C B B C C!E!EFFEECBAA@AAABBA@?=;;;= ? ? ? ?< =><;;;::9:;:998667743321100224300//..,,,,+,))))()**)(&&$#""!   !!$$$$$%'((%!'%,*-/ .0!/1"02"10#21%35%35)57*68+79,8:-9;/;=/<@1>B/?B0@C1AD4DG3EH5GJ7IL9KN:KQ;LR?NTAPVBRUEUXFT\HV^JX`LZbM[cSaiSehWil]or`rufx{i{~l|pruxx}~|}|{{zzz{xxxxxutk~gzVkPeI,>I-=G.>H/=E0>F0>F1?G1?I1?I1?G2@H2@H3AI0CJ0CJ.CJ.CJ1AK1AK1@L0?K2?K4AM2BL2BL1DK0CJ/DK/DK/DK0EL/DK0EL2EL2EL3FM4GN7HN7HN8IP8IP8IP8IP;KNLV=KU>MS>MSANTCPVBNVBNVBOUBOU݇JhcE;0_U2_:0]8/\7.[6/[3/[3.Z2-Y1*Y/*Y/'X.&W-'V,'V,+V*+V**U)(S'*R'(P%'O$'O$(M%&K#$J"H GEFFIJ%N!'P#+O#,P$-O#-O#,O-P ,S/V",V&.X(/W,/W,/X+.W*+V)(S&&Q%$O#$N#M%L$K#I#I"I"I"H!G G G!H!H#F"ECBBBDC B B C!D!E!EFFEECBAA @ @ @!AAB@@><==>@@@">!=!<"= =<;:;;;::99998877654221011343311/.... . ,,+***))****('&& $ #!"      "$$%&&(( )!'!%  #!(& -+".0$02%13%13$24%35$56&78(9:):;*;<+<=,=>->?/@A1BC1AD2BE3DJ3DJ4EK7HN8IO:KQ;MP>PS>SU@UWBWYCXZCV]FY`J[bK\cO`gSdkWil[mp]rtbwyh{|k~oqtwy{}~~~~~}||||{{yxvusro~n}bu\oI^>S4H1E->,=,:)7#0!..-,)%"                             ~ ~ ~ ~ ~ ~}}}}{{{{{{{{{{z{zzy xvvvvvvvvvuuuuuuuuu s s q q p o m mlllllll kiihiggggee c c ` ```__ \ \Z Y W VSS Q Q L L LNNNPPR QMQ+O$2V&;J&;J)=H*>I*?F)>E,>H+=G/=G0>H0>H1?I0=I2?K2@H2@H1BH1BH0DI0DI.CJ-BI/BI/BI0CJ0CJ1AK2BL2CJ3DK1DK1DK/DK/DK1FM0EL1FM1FM1GL0FK6GM6GM9IL8HK9HN:IO8IO8IO9KN9KNMS>NQ>NQ?OR@PS@OU@OUBOUBOU褽l%TL/^V:lS9kR=iH9eD7d?4a<3`;1^9.^8,\6+[5+[5,Z2+Y1*Y/*Y/)X,)X,'V*'V*(U)(U))T((S')Q()Q('O&&N%$L##K"JHHHHJJ"M $O"%P#)P#*Q$+P!+P!)Q *R!+V"-X$-Y)/[+0[.0[.0Z*.X(-T'*Q$)O$'M"&M %L%K $J#I"H#J#J"H"H F F GF"D!C!B ABDDDCCEDDEEEDDDCBA@ABB C CBAA@@@@@@@>> >!? =<<;<<;:99:9:976765443221222221200.--.*+++,++***))('&&$#!!!! ! ! !"$$$%'()!*")&" !"%",)/,1223 34!45#45%67"78$9:%:;&;<,A/?B1BC4EF4DG5EH5DJ7FL9HN;JPMS>QR@STAVWAVWCXZDY[G[`I]bM^dO`fTdgYil\mnarsfwxj{|o}stwwxz|~~~}}||{|{zyxwwutp}o|lj}TkKb8R2L*B(@)<%8#3 0//-,('$                       ~ ~ ~ ~ ~~~}}}}}}}}}}{{{{{{zzzzy xvvvvvvvvvvuutttttt q q p p m mmml kl k kl k kihgggggge d a ` ` ```_ ^ [ [Z Y V URR M M L LMNOPRRR QM T%1N(4Q+G*?H*?F)>E.?F.?F.?E/@F,?F-@G+@I+@I-BI-BI-CH-CH-CH.DI-BI,AH1BI2CJ2CI2CI0CJ0CJ0CJ1DK1DK1DK/EJ0FK.GK/HL.GK.GK/HL/HL1GL3IN9IL9IL9HN9HN6IP7JQ7LN8MONQ=KS=KS=KS=KSkS?lT=jM9fI6dC3a@1a;0`:1^90]8/\7-Z5/Z5.Y4+Y1*X0*Y/*Y/(W-'V,+U,)S**R)*R))P)'N')N&'L$#K"!I JIHJJK N "P"#R #R 'R 'R 'Q!'Q!*Q",S$-W'0Z*/Z.1\0/[2.Z1-X,*U)+Q&)O$'M"%K %K %K $J$J#H #H #H #H #G!#G!!E!E"F!E$D#C#C"BCCCDDDDCCDDECCDBCCACBB B B A@AA@@@? ?>>> > >>====<;:999:<;8876443322222222100/,,,,****+***((''''&&%%$$$#!! !!"#%'( (")#)!&!!"(%/, 2/ 34!45#45$56&78'89%:;&;<'<>)>@-=@.>A/?B1AD4DG5EH5EH5EH8FN:HP;JP=LR?NTAPV@RUBTWBWXCXYBY[D[]G^`JacPbeRdgWhi\mn`qpevuky{o}q~stwxy{}~~~~~}}||{yyyxwxwutqp~l~k}^sVk@\1M*B)A&<#9"4 2 10.-*($             ~ ~~~}}}}}}}}}}}}}}}}{{{{{{{{zzyyyxvvvvvvvvvvuuttttr q o ommnmmm k k i iiiiiiihgeee dd c a ` _ _ ^_ \ [ \ [ Y XUU O N L L JK NORRSS OQ#N!*U'5L)7N,:I-;J)=H)=H)>G)>G,>H-?I/@F/@F-AF-AF+@I,AJ+@I,AJ+AF,BG/CH.BG.AH.AH0AH2CJ2DG2DG1BH2CI2CJ2CJ4BJ4BJ5CM5CM0EL0EL1FM1FM1FM1FM4GN4GN8FN8FN9GO:HP6IP6IP7IS8JT:KR;LS=KS=KSiQ;fN6eH3bE1b>/`<2_:1^92^60\41Z30Y2+Y1*X0*Y/*Y/+W.*V-+U,)S**Q*)P)*N()M'(M%'L$$J#IJIJL L#!M$%P$%P$%R &S!(S'R'R(S'V$)X&+Z)-\+0[//Z./W,-U*-S(+Q&-N$,M#%K $J%K %K %K #I#I#I%I%I'G!'G!&F %E&E%D$D#C#C#C!D!DCCCBAA C C!D!DDCDBCCBBAB!A!A!A!A!A!A!A!A!A @=== > > >>=>>==;::999;:98875543321100100000--,+*)))+***''''&&$$""##!   !""# $% % &!(%(%&#"#!*( 0-$41#43$54%65'87(9:):;(:=*NQAPVBQWDTWFVYEWZFX[F[]I^`I`bMdfPefTij[lk_podutgxwoz~s~uwwxy|}~}|||{{zz{zzyyxxwwvs~r}k|j{cz\sGd4Q&E%D$= 9$1$1%/%/%/#- )(#         ~ ~ } }}}}}}}}}}}}}}}}}{{z{{{{{zzzzzz x xvvvwwvvvuuuvvvtttt q q p o l lllnmm l k kiiiiiiiiggeee d c c ` `_ ^ \ \ [ [Z Y V VR Q M LM LNOPPSSS RLS+K%2R+9I-;K/G.?F/@G1AD0@C1@F3BH,AH-BI.@J-?I/?I0@J0AG2CI0DI.BG.BG0DI/DF/DF/DF0EG2CI2CI4BJ5CK7BM7BM5CK6DL4EK5FL5FL6GM7GJ7GJ8HK8HK9HN:IO:IO;JP;IQ;IQ;IQLT>LTBKVCLWDLYCKXۚPqV(I.@jGIsPEkUAgQAdI?bG=!<!<!=#?">"> <;====!;!; 9 99:9999765444543311//00//..-,))))))))''&&%$##""!  !####$&(* * '%'%% "!'%,*$41&63)64*75,98-:9.:<0<>/=?1?A/@A/@A0AB3DE4DG6FI7GJ8HK9JK;LMOP?ORAQTCSVEUXFVYGWZHX[K[^K\bN_eNcePegUhiYlm_pofwvlyxn{zq}twzz|~~~{{|{yyyxwvvvwwvt}q|p{n}jyZoPe7N"9w#1*$.$.'/&.$,#+&#"!         ~ ~ ~ ~ ~~~}}{{z{{z{{{{{{{{}}{z{{{{{zzzzzyyvvvvwwvvvutttttutttt q qoo lmllmm k kiihghhhhhggggg d d c b ` `_ ^ \ \ [ Z Y XSS Q PMM LNNOSSSS O OK%T%5L(8O-H.>H1@F1@F4AE3@D2BE2BE1CF1CF0AG0AG3AI2@H1BH2CI1CF1CF1BH2CI2DG1CF1CF2DG5DJ5DJ7DJ7DJ7DJ7DJ7DJ8EK8DL8DL9EM9EM7GJ7GJ7GJ8HK9IL9IL8IO8IO8IP9JQ9IS:JT2^=2]8/Z5/Z5.Y40Z1/Y0.V2-U1+S/)Q-(P''O&(L&(L&)K%(J$(K#(K#'L$(M%&N%&N%'O&'O&(P%(P%(R"(R"'T"'T"&V!(X#+[&/_*2^.1]-2Y*/V'/R".Q!.N".N"+L"*K!(K#&I!&J%I'I'I'I'I'H'H'G 'G %H $G#F"E"E!D#C"B"C"C#B#B#A#A"@"@"B"B C!DDDBA @? @!A!A!A @ @ @!A @?!>!>==> ? @!A @ @ ?=<<;;!:!:!9!999::::8766555522110011//,-,,+**)**))''('''%$!!!!! !#$###$' )"*"+#*$)#'!$!% +$!2+%52)96+;8+;8/;=1=?2>@3?A/@A0AB1BC3DE4EF5FG6FI7GJ9IL;KN;KN=MP?ORAQTBRUCSVEUXGWZHX[IY\IZ`K\bJacMdfNegQhjYkn^pscsvgwzjz}l|p}uwz{~}|{{{{yxwwvuvvvuts~r}p{nzmycx_tJe4O{7+t&."4 20-)(%!               ~ ~ ~ ~}}{{{{zzyyyyyyyyyyzzzzz{{{zzzzyyyyyyyxvvvvvvvvuvuuuuut q qrr q p m mmmmml k k k i iiiggghhgggeee d c b _ _ \ \ \ [Z Y U USSSS O OPPSSSSR Q LR)M#/S(NQ@LTAMUDNVDNVp'F6(Y=ArVEoYCmWAjP?hN;eI9cG8cD6aB4_@3^?2^=0\;-Z5-Z5/Z5-X3.V2,T0.R.,P,*N*)M)(L('K''M"&L!'M"(N#)N&)N&'O$'O$(P%)Q&)Q&*R'(T$(T$&U#&U#'V$)X&2]+3^,7],5[*4W(1T%.Q"-P!)P#(O"(N#'M"&L!$J%I%I%I%I%I%I'G 'G 'G 'G #H "G"H F GF#E"D$D$D$D$D"C!BCCDDDDDD!C B???@@@!A!A!A @>>==== ? ? ?!@!@!@ ?><<::::99999::97655442122222100/.,,++*++***)))(((&&$"!!  " !#$##%& (")#(%)&*')&'$$!$)#0*#60*:7,<9.>;0@=0?>1@?0AB1BC2CD3DE2EF3FG3FG3FG7GJ8HK?JN@KOALPDOSAQTBRUBTWDVYEWZGY\HY_J[aI]bL`eNcePegTelXip^ovbszfu{ix~l|qruwy{}~{{z{yxwwwvuttsvu~t}s|r{s|n}m|d{[rGc;W%@!<|,B(>!:60.'#          }}{{{{yyyyyywwwvwwvwvwvwwwwwwwwwwwvwvvvvuuuuuutttttttt q q p p o ommmm k k k kkkiiiiihggggghg f d c ` ` \ [ [ [ Y Y W VUUUV W V U U U U U USSOOL$V%1M)5Q+=H+=H.>H-=G/=G/=G/=G0>H0>H1?I2@J2@J0AG/@F.AH/BI-BK-BK.AH/BI1BH2CI0EG0EG0EG0EG5DJ4CI5DJ4CI4BJ5CK3DK3DK3DK3DK5CK6DL7DJ8EK;FJ;FJMS>MSBLSCMTDNVDNVЃ1PBJ->mPGsXDpUCmQAkO>hL>A@A@@?=>>>>=???? ?>=<::;;::::::9865553222112121//10.-,+*++*****(((('&$"!! !  "$%%&'( ($)%*&+'-&,%)#& &#-*"41'96-=:/?<0@=1A>/@?1BA3DE3DE5FE5FE5IG5IG3IG4JH9JK:KL@KOBMQCNREPTDQUFSWDVYEWZGY\HZ]G\^J_aLacNcePegRgiYgo]kscqyft|hv~lzprtyz~~~{z{{{{zyxxwvvvtsut~t~t~q|p{l}k|f{bwSiI_AW7M+?';!53/("                          { z{{zzxyxyvvvvvvvvvvvuvvvvvvvvvuuvvvutttttttttttttrr p q p p p o m ml kl k k kkkiiiiiihghhhge d ` `_ ^ [ ZZ Y V WSSSS VX[Z[[ Z[YXSSOQ"K#-V'9I);K)=H*>I,>H,>H.?F.?F.>H.>H.=I/>J/?I/?I.?F0AH0AH1BI.@J.@J1AK2BL2DG2DG2DG2DG4BJ3AI4BL5CM5CM4BL5CK5CK3DK3DK1DK1DK1DK1DK5DJ6EK7GJ8HK8HK8HK9IL8HK8GM8GM8HR8HR:HP;IQ;IQ;IQ;JP;JPMS@MS@MSDNVDNVܞGc^F/7dMErUFsVDoWAlT0[<0Y9/X8/W3-U1.S1-R0.P1,N/)N.(M-%M)%M)#P$#P$#Q#$R$%S%&T&%S%&T&$S'%T($S'%T(%U'&V(,W%,W%-X&-X&/W&/W&0T(.R&/O(-M&-M&-M&(O"'N!%N!$M $L!"J!J!J!L!L#K#K#K#K#J#J I IHG IF!F!F"F"FEEEDEDDDDDEDCCBAABABA@??@>>?>?>==>?? > >=<;;:::::::::87654432222320/000/.-+++++***))((((('%$"!  !$%%&'( '$(%+',(.*+')%'#*'1.':4-@:.@=/A>/BC/BC1CF1CF5EH5EH6GH7HI6JH6JH8KL9LM;KN>NQBOSDQUDQUFSWFVYGWZDY[F[]E[`G]bH]dK`gNdiNdiPfkTjoXlq^rwbu|exh|knpwy{}~~}|}}}||{{ywwvvutsr~r~q}s|r{r{t}ts~izduYjJ[7D3@)8%40+#                                    ~ ~}}{{{{{{y xvutttttttttttttttt q q o pmmmmmmnmoommmmmmmmmm k kkkkkiiiiiihihghgee c b _ ^ \ [ V V S SSSSTXX]^`aaa ^ ]VV O OI!P0K!4O'=H'=H)=H)=H+=H,>I.>H.>H.?E.?E.>H/?I/>J.=I0?K1@L/BI.AH.@K.@K1AK1AK4DG4DG4CI4CI5CM4BL3@L4AM6@M5?L6@M6@M4BL5CM3DJ3DJ/EJ/EJ2FK3GL6FI8HK8GM9HN8HK8HK7IL7IL4JO4JO8IO8IO:HP;IQ9JQ9JQ8LQ9MR8LQ:NS=NTMS>MS>MS?NTBOUBOUhUEO?4kJ=tSCpSAnQ>kL=jK9gF7eD7cB4`?2[;0Y91Y6/W4/U1.T0-S/,R..R.-Q-)O+)O+%Q)$P(%R&&S'%R&%R&&T&'U'$U$%V%%U'%U'%T(%T(%V%&W&(X#)Y$-X$-X$,V&*T$)Q&(P%'O&'O&)P#)P#(P'O$N$N#L#L$K#J#J#J#K#K#L#L%K%K%J$I%H#F"F!E!E"F F FEEDDEDDECCDCDCCBBAAA@??@@?>?>>?=>?@@@??>=<<<::;;::9877544322223210///.+****)))**((''((''%%#"    "#$%&'( )!(%*'-*.+/(-&*#*#1*!92*?9-BOPARSDRTFTVGUWIWYGWZJZ]I[^K]`I^`K`bMbdPegPdiSglVjoZns^rwdx}d{}f}kosvy|~~|||{}}}}|{xxwwvvutsst~s}q|p{n|n|l|jzeybvZoMb8M0E+=);&70(#                                  ~}}}}}}zzwvvvvvuuttt st s sttt q q n m m mmmllllll k klllllll k k kiiiiiiiihgggggee c b _ ^ \ \Z X U USSSSVW\\``d c c b [ ZVV NP"L*T9G#=K&@F&@F'?E(@F)>E*?F)?D*@E,@E,@E/?I/?I/>J/>J.@J/AK/AK.@J.@J.@J0AH1BI/CH/CH/CH0DI/AK0BL2BL1AK1BI2CJ2CJ3DK3DK3DK/DK/DK/DK0EL0EL1FM3GL3GL2IK2IK2IK2IK2IK3JL4IP4IP6IP6IP9JP9JP9KN9KN:KQ:KQ;LR;LRLT?OR?OR?NT?NT@NV?MUގ:m^G8%`A2mNBrR?oO>lK3`;2]8/Z50Y2/X1,X/*V-)U,)U,+T-*S,(T+(T+$U+$U+#V,"U+$W($W(&W&'X'"X%#Y&#Y'#Y'%X'%X''Y&'Y&'Y$'Y$+Y$+Y$*W%(U#)R%(Q$'P#(Q$(Q$(Q$&P %O$N$N"N!M!L K"K#L$K$K#L#L"J"J&I&I%H#F!H GGGHHGFGFFFDDDDDDDCBA@A@@?>???>?@?>?>=>?@@@??>=<<::::::9987666533332211//..-,**)))*))((((('''''%%$ #####%%&'*+ +%.(0)1*/++')%,(6/(@90DA2FC2FD3GE3FG4GH7GJ8HK9JK9JK;LM;LM>LN>LN>NQ?ORAQTBRUCSVEUXGV\GV\GX^IZ`H]_I^`LacNceOdfRgiThmXlq^oubsycw|fzjmnrvw{~}}}||||||{yxwvxwwvtsrqr}q|p{p{l|l|k{jzcvbuSmLf8S1L)B&?%81*'##!                                 } |{zzzxyvvvuuuuuttr q o pppmml k k k k k k k i iiikkkkiiiiiihhhigggg deee d c ^ ] Z Y V V S SRRRRSS W W]]degge c ] \ S R LS.L4R#>H$?I'AG'AG)BF)BF)BF(AE*@E+AF,?F,?F-?I.@J,@K,@K,@K,@K,AJ-BK-BI-BI-BI-BI-BI-BI-BI.CJ.CL/DM/DM.CL.CJ.CJ0DI1EJ1EJ1EJ1EJ1EJ2FK2FK5FL5FL5GJ6HK2IK3JL3JL2IK2IK3JL4JO4JO4IP4IP5LN5LN7LN7LN9MR9MRMS>NQ>NQ?NT?NT>LT?MU鮾_~(MG#W?.bJFpTCmQBkK@iI;hC9fA7c@3_<1]<.Z9-Z5,Y4)Z0'X.&V.%U-'T/'T/'V,'V,!W,"X-!W,!W,%X)%X)%X'%X'#Y'#Y'#Y'#Y''X''X''Y$'Y$)Y$)Y$+Y$*X#)U%(T$'R%&Q$&R"&R"'Q!'Q!&P %O"O#PQO!M L&J'K&L%K'K&J%I%I'I(J&I%H IHHHGG G GF GFE D DCCCDDDCCAAA@>>==<=>>??@??@@@??===<<;:::;::9887777643223310/0/0-+*)+***((''(''''&&&%%$$$$$$%%&(* ,".$0&1)1)/)+%,%2+)<61D>5FE5FE4GH4GH5HI6IJ9IL:JM=KM=KM>LN?MOBNPCOQCMTEOVERXGTZFU[GV\FW]GX^F\aG]bG^`JacNcePegRgiTikXjm^pscuxewzfzi}npvx}~}}|||~~~}yxyxzyyxtssqr~r~q|p{l|l|l|jzgxduWlPeG&?H(AE(AE)BF(AE(AE(AE+?D,@E0?E0?E1?I2@J,AJ,AJ,AJ+@I+@I-BK-BK.CL.CL-BK-BK-BK,AJ-BK.CJ.CJ.DI.DI/CH0DI4DG5EH1FH1FH1EJ2FK4EK4EK7GJ6FI6HK6HK4HM5IN5IN4HM3JL3JL3LP3LP3LP3LP5LN5LN9KN9KNNQ>NQ>MS>MS?NT>MSс9YZLA%YNAlTAlTBlI@jG@hD>fB>=>@@@AAA@@!@!@ >=>>>>;;::::::!: 9664 56543221200////,,++**++*)''(())'&$""#$%'&%&&')*,"/%.'!0)"2(#3)/'-%-*'967GD7GD9IF;KH:IH;JI;HLKO>LN>LNBONCPODQPERQEPTFQUEUXGWZIX^JY_IZ`J[aK]`N`cPabRcdUehVfiYil\lo_pqevwiz{k|}n~rvxx|~}|{{|{{zvutssr~r~q}p}p}p}o|lyiv`pWgFV@P8B4>/7)1#+!)&%#!                         ~ ~ ~}}{zy xyyyyvvvuuutt q p m m kl k kiiiiiiiiiihiiih f d d d deed c a `__ \ [ Y Y W VSSSSVVWVUV WX]^fghh d c Z YPU*N$0T(;I)LT?MUBOUANTANTBOU_~}OGH@/gI7oQ?nJ=lH=iF:fC9eB7c@3c=1a;0`:/_90^6/]5.\4.\4-[3-[3-[3.\4.\4.\4-\2+Z0)X,(W+(Y()Z),W+-X,-X,,W+*W+*W++V)+V)0V%0V%0V%/U$-T%,S$+R%+R%,P%,P%+O$+O$(P(P&Q%P%P$O$N#M#I$J&J%I'J&I%I$H%H'J%I%I%I$H$H#G"G"G"G"G$G%H&F%E$E$E FEDCDDDD!B!B A ABB@?@?BBAB @?!?"@"@"@"? =>>>>==<;;;:: 87 546655441112//0///-,**)(++))(())((&&!"#$$%%%%'()+ ,!,'.)!/*$2- 4,3+0*0*!84+B>2KG2KG7MK7MK9LM9LM:LO:LO;LR-4)0",!+)'&$                   ~ ~{{{{{{zzy xxxvvttr q p p m ml k k kkkiihghgggggeed c c c c c_ ^ [ [[[ \]] \ Z Y Z [^] \ Z V W W W]]dehhf d [ \ R'Y4N#9S'=H(>I,@E,@E-AF-AF)BF(AE*?F*?F.?F/@G2@H1?G1?G1?G0@J1AK.CJ-BI.CJ-BI.CL.CL.CJ.CJ.CL,AJ-AL.BM2BL1AK2CJ3DK1DK0CJ2CJ3DK4EK4EK6FI7GJ8HK7GJ8HK9IL9HN:IOKOALPALP>JR?KS>KW>KW>KW>KW>LV?MW?MU@NV?MU@NVݒ5_X>7(a@6oN@pOjG>??<<;;;;:: 87778888443321100000.-,,**+*))))))'&%%$%&'&&%%())*+#-%.)/* 4,!5-4.3-1*5.&@9.HA4NG5OH8NL8NL=NO>OP=ORL)@I)@I+@G+@G+AF,BG+AF+AF+AF*@E/@F/@F0AG0AG1?G1?G0AH1BI-CH-CH.DI-CH-BK.CL0CJ/BI/BI/BI/AK/AK2BL2BL2CJ2CJ2CJ2CJ/DK0EL2EL3FM7FL7FL8GM8GM9HN9HNHP>GR>GR=IQ=IQ;JP;JP;JP;JP;JP;JPmP?kH=iF:h@8f>7e=6d<7c:7c:4d63c53b83b80a70a71`61`60_5.]3.Z2,X0-X,-X,,W*,W*0W*1X+2V+1U*/U*/U*.T)-S(,R',R'-R#-R#,P$,P$+O$+O$+O#+O#,R!+Q +Q *P)O)O(N(N'L&K&K&K'K&J$K#J#L"K"K#L'J'J'J'J'J&I%H$G$G%H$G$G&F%E%F&G%E%E EDFF!D!D#C#C#B#B#A#A#A#A!A!A!B!B!A?#="<">#?!@!@!@ ?@?>> ; ;9 : ;:::9877875555432011/011/.-,++)())(('&%%%%$%&'&&&')*+,,".$1)3+"6,#7-#7/3+/,'962FC8LI:NK;OL>OP?PQ@PS@PSAQT@PS?QT@RUASVBTWEWZFX[GY\GY\IY\K[^M]`N^aOadOadOdfPegQfhShjYilZjm]mp`pshu{lyn{q~tyz{{~~~~~~~~~}}}|{zyxxxxwvvvutr}r}r}r}q|q|gygySj=T2B/?.8,6'2%0-,*))&&$                    ~ ~~~}}{{zzzzyxvvvuttr q p p m l kl k k k kiihggggghgeeee c c _ ^]]__`a` _ \ [ \]_^ \ [ Z Z \] ^ ^ cdhe ]_ R(Z 7M#:P$@H%AI)@I(?H(@F)AG+@G+@G+AF+AF+BD+BD0BE/AD0BE1CF/@F0AG/CH/CH-DF-DF-CH-CH.CJ-BI1BH1BH3AI2@H0?K1@L2BL2BL4BJ4BJ5CK5CK3DK3DK4DN4DN7EM7EM7FL7FL8GM9HN9HN9HN;GO;GO;FQLTBLSBLSBLTBLT>LT>LT@OUAPVސHdd.%,RIEnTClR>lK!@ ? ? ?>>==<<:9 : :9987777766564322////00/.--+**)))'''&$$$$$$%&''((*,+, ,"/%1+!4.#60$71!521.#670CD8IJKO?LPALPALPDMQDMQBMQBMQ?OR@PSy<5?8,aE:oS9e=8d;7c:9c:9c:8b97a87b65`42]11\00[//Z./[+-Y)/Z(/Z(.Y'.Y'/V'/V'-W'-W'+V)*U()T((S'*R'*R'+Q&*P%*P%)O$+O$*N#*O *O +R*Q*P*P*O )N)N(M(N(N'M&L%J&K%L$K$K$K#J#J#J$K$K$K#J#J$H$H$H#G$F#E#F#F&F&F$F$FFFEE!D!D!E!EFFF G D D"C"C"B!A!A @ > >=>@@AAAA?? =<<;":!9!9!9!:!:7765555543100////00/.-))))(((('&$$$%$$%&'''(+,, -!0%2' 4,#7/%82%82#52$632CD=NO?PQBSTCTSDUTDUVDUVDTWDTWGS[HT\FT\GU]FX[HZ]K]`K]`L^aM_bM_bN`cPbeRdgPegRgiSglUinXjmZlo_orbrufu{jym{qsxz{~~~|zyyxxwvuuvts~q|q|r}q|q|p{n{o|dw\oE]9Q2G,A):&7"0!/ ,++*'$                    ~ ~ ~ ~ ~ ~ } }{{{{{{{{zz x xvvvvvvuu s s q q p ol k k kkkkkiiiiiiiihihhgghggg fg c b _ ^_ ^__ \ \ \ \] \] \ \ [ VX!R'X 7M#:P$@H$@H)BF)BF,CE+BD*@E+AF+AF+AF+AF+AF+AF+AF-BD-BD-AF-AF.?F/@G/DF/DF/DE/DE/DF0EG0DI0DI1BH0AG1>J2?K2?K3@L3@L2?K2BL3CM3DJ3DJ3DK3DK4EL4EL7EM7EM7EM6DL4GN4GN3JL3JL7HO7HO9GQ9GQ8IP9JQ8IP9JQ9JQ9JQ;IQNQ@MQ@MQ>NQ>NQ?OR@PSߠ4ib:3A-)bN=mL:jI;hC9fA;fA9d?8d<7c;8b98b99a89a87_45]23]-2\,0]+/\*.\'-[&/Z&/Z&-X&-X&/X$/X$-X&-X&+W'*V&&W&%V%'U''U'*S&)R%(Q$'P#)O$(N#)O$(N#(O"(O"(O (O (O (O (O"'N!(L )M!&K%J'K'K&K'L%L$K%L%L&L!&L!$L##K""J!I#I#I%I$H%H#F%G%G%G%G$G$G"F"F!E D"E"E!G F G G!G!G$F$F$E"C"D!C!C!C"B!A!A"B#B#B!C BAAA@>> =<!< ;:::::9776666432200101110/.+,++**))&&&&%%%%%% ' '()*,, /#2'4)"5/$71&93%82!30/A>;LKEVUEVWEVWEUXFVYFVYFVYFVYGWZGU]HV^IW_IW_G[`I]bH_aI`bN`cOadPbePbeRdgSehQhjSjlTjoUkpZoq\qsbtwdvyiy|m}psvy{}~~~~~}}{zyyxxwvvvuuts~r}r}r}q|q|q|o}n|h|g{RiE\/J+F'>#:"73/-,*)'!!                     } } } }}}{{{{{{{{{{{{zzyyvvvvvvvvttttttr q o ommlll k k kkkiiiiiiiiiiiiiigg d d a ` _ __ ^ [ \ \ \ \ Z [ ZX WRW.N3S#=J$>K(@F(@F)AG)AG+AF+AF+AF+AF+AF+AF+BD+BD+BD,CE+BD,CE+BD+BD,AH+@G,BG-CH-DF-DF-DF.EG0DI0DI/BI.AH.@K.@K0?K0?K0?K1@L2CJ3DK2CI2CI3DJ4EK4EL4EL7EM7EM7FL7FL5FL5FL5IN5IN7HO7HO7HO7HO6IP6IP6IP6IP7JQ7JQ7LN7LN:LO9KN9JP9JP9JQ9JQOP>OP?OR?ORr(PO+!I?>gHAjK>gH;dE=eB!8500/.*(" !          ~ ~ ~ ~~~~~}}}}{{{{{{{z{{zzzzzzzzyxxxxxvvvvvuttttttr q p p n n l lll kl k kl k i i i iiiiikllkgg c b ` _ \ \ [ [ Z[[[ Y X T TQT$P*V6M!:Q'@J&?I(@F)AG+@I*?H/@G.?F0AG0AG/@F0AG+AF+AF+BD+BD+BD+BD,CE-DF-CH-CH-CH-CH0AG0AG2AG3BH1BH2CI0DI/CH.@J.@J0@J0@J0?K0?K1AK2BL2CI2CI3DJ3DJ4EK4EK7FL7FL8EI9FJ7GJ7GJ9HN:IO8HR7GQ7HN8IO6KM6KM4KM5LN5LN5LN7LN7LN9KN9KN9JP9JP9JQ:KROP?PQ?PQ?PQlMD90V3-iF;gD9eB?dD?dD=b@">!= :9#:#:#:#:!:";;;::886655432000/.....,+***)))'''''''' ( (((*))**"+#.&1) 4,"6.$71(;5'96*<96GFCTSGXYHYZIZYIZYIZ[J[\K\[K\[L]\M^]M]`N^aM_bN`cMbdNceOdfPegTdgUehUdjXgmWilXjmYnpZoq^ouarxfw}hym|qux{~~~~~~zz{{zyyxxwvvvuus~s~r}t}t}s|s|s|s|s|r{p{ozmykwXlH\1L.I'?#;!64/,*(&%!               ~ ~ ~ ~~~~~}}{{{{{{z{{zzzzzzzzzyyyyxxxxvvvvvvuuttr qrr q q p p n m l llll k klll k k k kkkkkkkkkgg c b _ _ \ \ \ Z YZ YZ W W QSQ$V0O!5T'=J)?L*?H*?H+?J*>I+?J+?J,?F-@G2AG2AG1@F1@F1@F0?E0>F0>F/@F/@F,BG-CH,BG-CH1BI/@G3?G4@H4?J5@K2CJ2CJ.DI-CH-BK,AJ.@J.@J3AK3AK4BJ4BJ4BJ4BJ3EH3EH2GI2GI2GI3HJ7FL6EK6EK7FL6GN7HO3HO3HO5IN5IN5JL6KM7LN7LN6KM7LN5KP5KP5JQ5JQ7KP7KP9JQ9JQMSR~2/:"$ZB:eF=hI<<:;;#;#;!:!:;;;;9866 655421110//0//.-**('''''''&&&& ' ' ')*+*"+#,$.&0*2,#60%82(:7*<9+=:5GDFUTJYXJ[ZL]\K^_K^_M^_M^_N_`O`aK`aMbcKccLddOdfOdfPdiPdiQfhShjTikTikTjoTjoUlnWnpZpu\rw_uzbx}h}i~rux{~~~~~}}}}|{{{zzxxxvuuwwtts~s~r}r}r}q|q|q|q|p{p{p{jyn}gzYl=\4S#G?730/-+(&%#!                  ~ ~ } }{{{{{zyyyyyyyy v vvvwvvvvvvvvvvvvvuuvuuutt q q q q q q q q o ommmmll kll k i i ij k k k kiihg d d ` `] \\[ Y YUUUU SUQU)R.W:L =O&?I'@J)AG)AG*?F+@G+@G,AH,CE,CE.CE-BD1?G1?G0>F0>F.?E/@F-BD.CE-DF,CE-DF-DF2AG3BH3AI3AI3AI3AI2CI2CI.EG-DF-BI-BI.AH/BI1BH2CI4DG4DG3DJ3DJ1EJ1EJ0FK/EJ4EL4EL7EM7EM7FL7FL4HM5IN5IN5IN5JL5JL6KM6KM9JP9JP9JQ8IP7JQ7JQ7JQ7JQ9JP9JP9JP9JP;JP;JPLT>LTܐ9ZY5)@47dG>kN7b=9a89a87_65]4.]1.]1.]1-\0-\0+Z.+Y++Y+,Y'+X&-X&,W%,W%,W%,W%,W%+U%+U%+U%*T$,S$,S$+S"+S"*Q"*Q")P!*Q")O$)O$)O$)O$)P#'N!'M'M'N(O)P)P(N(N)N)N)L$)L$(K#(K#(K#(K#'K 'K &L%K%L%L$J$J$J#I%I'K'I&H!IGHHHH#F#F#E%G#G#G%E&F'E&D&F%E!E!EDC!A!A#B"A$@$@"A"A"@!?@@?=>=:;:;;;::887 8 766520111100..,,))((('''&' ' ' &' &'(** * *#+$.(0*2, 5/%82(;5+=:.@=7HIEVWQbcN_`L`^L`^M`aNabPabPabPabQbcNcdOdePefPefUehTdgVfiWgjVhkXjmXjmYknZlo[mp[pr\qs`tybv{ey~h|pry|~~~~~~}}}||{{{zyxxwvuuutssr~r}r}r}r}s|s|s|s|s|s|oznygwcsVkK`4M*C';$8$3!0.+))(&!                 {{{{zzyyyyyyzyyyvvvvvvvvvvvuvvvvvuuuuutttt q q q q q q p p m mmmlllll k i iiilll k i ihge d c b _ ^ \ [Z Y V VSSSSRV!Q'W3N9T#@L#@L*AJ)@I)AG)AG*CG+DH)DH(CG(DE(DE,BG,BG1?I0>H0>H0>H-AF.BG,CE,CE-DF-DF/CH/CH2CI1BH4CI3BH3AI4BJ1BH2CI.DI.DI.CJ.CJ-BI-BI0EG0EG1FH1FH1DK1DK/DK0EL/DM0EN4DN4DN5EO6FP4HM4HM3IN3IN4JO4JO6JO5IN8IO9JP;JP;JP8IO9JP5JQ5JQ5JQ6KR:LO:LOgO;:9:;:::888866431000////.-*)((((&&&' ()('&''()++#+#,$/'0*2,4.!60&:7*>;*>;1EBATUFYZMa_Nb`NabNabQbcRcdRcdRcdPcdQdePfdPfdQfgRghWgjVfiXhkXhkZjm[kn\lo^nq_oraqtcuxdvyfx{i{~m~qty~~}}}{yyxxvvuttussr~r~r~q}q}p|q}q|p{r{qznynylwlwdu[lD[8O,D(@'8#4!0.,-*($#"!               ~ ~ ~ ~ ~ ~ { {zzyyyyxxxyyyyxvvvvvvvvvutttttttttttttt q q p o o p p p p o m m kl k k i iiiiiiilll kihee c b _ ^ \ [ Y Y W W V USS P QS!X,N3U=M >N&AK&AK*AJ*AJ(CG(CG(CG)DH+DH*CG+DH*CG-CH,BG,BG+AF+@G+@G,BG,BG,CE-DF-DF-DF.DI-CH/DF/DF2CI2CI2CJ2CJ0DI0DI0DI/CH.DI/EJ-DF-DF.EG.EG/EJ/EJ/DM/DM0EN0EN0EN0EN1FO2GP2GP3HQ2HM3IN8JM8JM8JM8JM:JM:JM:JM:JM;KN:JM7KP7KP7KP7KP;KNKO>KO>KQ>KQLT=KS>LV>LV>KW>KWZ 355*"TI>iQ=hP9fG7dE9d?6a<9`99`98^:7]9/\7.[6,]3,]3+\2*[1*Y-*Y-(X*'W)+W'+W'+V)+V)+V)+V)+V)*U()U%(T$*T$*T$,S$,S$.R&-Q%-Q%-Q%)R%(Q$%R&$Q%#P$"O#"N%!M$#M$#M$%M$%M$'L$'L$(M%(M%%M"%M"$M %N!%M"%M"'M"&L!%L#J$J#I"J"J"K#L#K#K#G!#G! G EDEEFFF!F#H #G!#G!#G!"F $D$D$D$D D D D D A@"?!>"?#@#A"@@@CCCB?=;;99:9:989::865422//0/..-,*))('' ( ( ( (((&'' ' '!'!)* +#-%/'1)3,5. 81#;4'>:-D@7GJAQTM[cQ_gRbeScfOdfOdfNegNegNegNegNegOfhOfhPgiRgnRgnUhoUhoVhrVhrYis\lv^ov_pw_tvbwy`y{c|~d}hnrxy~~~}}|{{||~}zzyxuuuusssr~r~r~q}q}q}p|p|p|p|o{nymxmxmxhzgyWmLb6R/K)@$; 20--,*'&" ""              ~ } }{{zzyyyyvvvvvwwvuvvvvuttttttttr q q q q q q q q q o pmmmmmmmm k k k kiiiiiiiiiiiiiig f c b ` `_ ^ Z Z W WWWUU STQV)R-V6O:S#@J#@J)AG+CI+CI*BH)CI)CI(BH)CI*BH+CI-BI-BI-BI-BI*CG*CG'BF'BF(CG)DH+DF,EG,EG,EG,EG,EG.EG-DF/CH/CH0DI0DI0CJ/BI0CJ1DK,DJ,DJ+DH+DH+DH,EI/EJ/EJ/DM/DM.FL.FL/HL/HL/GM/GM0FQ0FQ3GR3GR8IP9JQ8IP8IP9KN9KN8JM9KN9KN8JM6KM7LN9KN9KN=JN>KO@JQAKRAKS@JRLT>LT>LV>LV?MW>LV桽Plm -) 1-hR=hI:eF7d?5b=6b:5a96^:6^:0]8.[6/^4.]3-\2,[1+Z.)X,*X*)W))X')X'+V)+V)-U*-U*,T),T)+T'*S&*S&*S&*S&*S&+R%+R%+R%+R%*Q$+R%)Q&(P%%O&$N%"N%"N%$N%#M$%M"&N#'M"(N#'M"(N#(O"'N!'N!'N!'M"&L!&L!&L!&J%I%J%J%L%L%L%L%J%J%I%I#G!E H HHGFH H!I #H #H $F #E"D!C#C#C#B#B"C !B!C!C#A#A#B#B#C#C A AABBA==;;989987899987653210/.-.++*)(())))''((''( ( ))* * ,&-'/+0,3/62#:6&=9.B?4HEGWZWgj[jpUdjUfeUfeTefUfgSehSehQfhShjQhjRikRikRikTjoTjoVjoWkpZkr[ls_mu`nvbqwetzfvyjz}k}opquwy}~~~~|}|{{z||{zuuutvt~t~t~r~r~q}p|q}p|l}l}l}l}nznzmymyjxhvcr^mM`DW2E-@$9 51/.+)%#"""              ~ } } { {zzyyvwvvvvvwvvvvvvuuttr qrrrrrr q q p p p p p p n m l l kl kll k k k k kiiiiiiiiiihhe d c b____ \ [Z Y V WUUSSRS$T(X6O9R#@L#@L'@I'@I*BH*BH(CG(CG'DH'DH(CG)DH.AH/BI1BI1BI,AH,AH,BG+AF*CG*CG+DH+DH+DH+DH+DF,EG.EG-DF0DI/CH3BH4CI4CI3BH3AI3AI.CL.CL*CL*CL)CI)CI)DH*EI-FJ-FJ/DK/DK0FK1GL1GL1GL1GL2HM2GN2GN2GP3HQ4IR4IR5JQ4IP4JO4JO4KM4KM3IN3IN5HO6IP;IQ;IQ;IQ;IQOV♫3]c*0Q@*`O8gP6eN7fB5d@5b=3`;3_>3_>1]:/[8/]5.\4/[2-Y0-Y0,X/-W.+U,+V)+V)+V*+V*-U*-U*-U,,T++S(*R'+T'+T'*S&*S&+R%+R%*P%*P%*P%*P%*O'*O''O&'O&#O&"N%&N%&N%%M"%M"'N'N)M!)M!)M!(L 'N!'N!'M"&L!*J#*J#)I"'G 'I'I%J%J%J%J%J%J&G&G%G$F%H%H!H G G G!G"H"H"H#F"E!D C"B"B$B$B#C$D"D"D$B#A#A#A CBA@@@@==;:9 9888889887876542//./,,+*)))))((((())(())**+ -",&-'/,1.62"95&=9+B>4GHDWXL]cSdjSglRfkRgiRgiTfiUgjUflUflUflWhnUinVjoVjoVjoVkmWlnZkq\ms]nu^ov_oyaq{du|ev}hyj{oqrtx|~~~~~}||{{|||{yxuuuuvu~t~t~r~q}q}q}p|p|l}m~k|k|lzkykykyjxjxhwfu^oXi?V3J{#="<541.*'""""        ~ ~~~~~}}{zyyvvvvuuvuvvvvttttttr qrr q q p p o pmmmmmmmmll k k i iiiiiiiiiiihggg fg d d c b ` `] \ \ \[[Z Y V UUUSSRUR!W0P5U!>J#@L(AK(AK)@I)@I*BH*BH(CG(CG)DH(CG,AH-BI.AH/BI/BI.AH,AH+@G+@I,AJ*CG+DH+DF+DF+DF,EG.EG-DF.EG.EG0EG/DF3BH3BH3BH3BH3BH4CI/DM.CL(DL(DL)BK)BK-BI.CJ.DI/EJ/EJ0FK/FH0GI2GI3HJ3HJ3HJ2HM2HM3HO2GN4IP4IP5GQ5GQ3IN3IN1JL1JL1JN1JN3HQ3HQ8IP9JQ9JP9JP:IU;JV;LS;LS;LR:KQ8KR8KR8KR9LS= <; 9 9 9888887788776542..,-..-.+*+++)((())))*++* * -".#-'/)0-"41 95#<8+B>1HD>QRRefWgjUehWgjXhkVhkVhkWilXjmZjmYilZioZioYjpYjpWkpWkpXlqYmrYotZpu\rw^ty_vxaxzd{}f}jmsvxy{~~~}}|{zyxxzzzzwuuuuutsr~r~r~r~r~q}o}o}k~j}j}h{h{gzizizhyhylwlwn{n{ShF[~*I&E>:2/*)%$""          ~ ~}}{{zzzzyxvuttuuuuvutttttttttt q q o ommmmmm k k k k k kkkkkiiiiiihhgge d d d d d c c ` ` ^ ^ \ [[[Z Y W VUUST SUSV)R.W#=R#=R*@K*@K+BK*AJ,AJ,AJ*CG)BF*BH*BH*BH*BH-BI-BI-BI-BI.BG-AF.AH-@G-AL-AL-BI,AH-CH-CH.EG.EG-DF-DF-CH.DI.EG.EG/DF/DF1BH2CI2CI1BH0CJ0CJ,DJ,DJ-EK-EK/EJ/EJ1FH1FH/FH/FH0GI1HJ3HJ3HJ3HJ4IK5JL5JL3IN3IN4IP3HO3GR3GR3HO3HO2KO1JN/JN/JN4IP4IP5KP5KP7KP7KP8KR9LS;LS:KR:KR:KR:JT:JT9JP;LR;MP9a=8`<5`;4_:1]4/[21[2/Y0/Y0/Y0-X,-X,,W*,W*,W+-X,-W.+U,*T+*T+,T),T),V&+U%+U%*T$+Q&+Q&+Q&+Q&+Q&*P%*P%)O$'O$'O$'O&'O&&N%&N%&O"&O"&O"%N!+L"+L"-M!.N",N"+M!+L")J +K,L ,L +K*I*I)J )J (I(I*J)I(H(H*G+H)G *H!*H!)G )H)H)H)H$H$H%I#G$E"C!A"B"E"E$D&F 'D%B%B#@#@$A$A#@ ? ? ?!@ ?> <; 9!:<;:988 76 8 866431/..--..--,*++++()()))***"*"*"+#,$-%.+0-!30$63';8-A>3FGBUVL[aUdjVfiWgjWgjYilZjmZjmZjmZjm[kn[kn[kn]mp]mp^nq^nq^nq_or`psaqtcsveuxfvyjz}k{~nppswx{}~~}|}}|zzzzzzzxxwvvwwvt~rrr~r~q}q}q~q~q~p}o{o{nzmymylxlwlwlwlwmylxdt\lH`?W-H%@'4%2%0*'&#!!!     ~ ~ } }{{{{zzyyyxvuuuvvvvuuttttttttr q p o m mllllll k klkkkiiiiiiiihggggge d c c c c b c` _ \ [ [ [[[ Y Y U USS SVSV&O-V5O!9S(AK'@J*AJ*AJ,AH,AH,AH,AH,CE,CE,AH,AH-BI,AH/BI.AH2@J2@J4?J4?J3>I4?J0?K0?K0?K1@L2@H3AI3AI3AI3AI3AI2CI1BH2DG2DG3CF3CF4CI4CI7DJ6CI6CG7DH3EH3EH/FH/FH3DJ3DJ5EH6FI2GI3HJ3HJ3HJ6FI7GJNQ>NQ?ORDry/6,&MG5bE3a92`81`6/^4/[2/[2.Z1.Z1-Z.,Y-,Y-,Y--W.-W.,V-+U,-U,,T+,T),T),V&,V&+U%+U%,R'+Q&+Q&,R'-Q&-Q&+Q&*P%)N&)N&)O$(N#&O"'P#'P#'P#&N#%M"+M!+M!,O-P *O *O *N#(L!*M+N*L *L *J#*J#)I")I"+I"+I"*I*I)I)I)H)H)H*I*H!*H!*H!*H!'G 'G 'G 'G 'G %E$D$D!C"D!E!!E!$E"#D!&C&C$A#@#A$B#A#A ?>>>!> = <;: ; ; ;9966 65555521110///00.-,++,++**((())* +#+#+#,$.&0(1+!4.#7/(<4+?54H>ASPL^[RbeUehWgjXhkZjm[knZloYknZlo[mp[lr\ms\ms^ou\qs]rt]rt]rtbqwbqwfu{gv|fw}j{n~rsusu{}~~~~~~}||}~}{zyxxxzywvvvvusr~r~r~r}r}r~r~t~s}s}r|p|o{o{mymylxlxlxmymymylxn|hvYoSi@Y1Jv';'; 41,*'#"     ~ ~ } }{{{{zzzzyywvuuvvuutttt q q q q qrr q q q o ollll k k k k i iiiiiiiiiiigg deee d d c c c c a ` ^ ^ [ [[[ Y Y W W V VTTTW&R)U3N7R#=J%?L,@K-AL/AK.@J,AH,AH,BG,BG.BG.BG0AG1BH0AH0AH2@J2@J2@H2@H1?G1?G2BE2BE0AG0AG1@L0?K2?K3@L3AI3AI4BJ4BJ2BL2BL2CJ2CJ4BJ4BJ6CI7DJ7DH7DH5EH4DG5EH5EH1FH1FH1FH1FH1EJ1EJ4EK5FL4EK5FL7GJ8HKJR@KOALP>KO@MQ@LT@LTh@C58#\C3lS:jJ7gG;eB9c@6a<5`;6^:4\82[41Z31[21[23[02Z/2Z/1Y.2X-2X-/W,.V+-U*-U*-U*,T).U&.U&/T%/T%0R&0R&0R&0R&0R&/Q%/P&.O%*O')N&)O$)O$)P!)P!)P#)P#*N#)M",M#,M#-P!-P!)P#(O"(N#'M")M!(L -M!-M!-L",K!*K!*K!'K (L!'K 'K 'H(I)H)H*I*I*H!*H!*H!)G )G )G )G )G +F!)D(D(D%E%E!E!!E!%D!$C %C%C$B#A%A%A%@#> = =>??>;;<< ; ;!8 7!7!7 64 3 31 233321///00.---,,+,)))))))* +!+!,".$0(2*!30$63(;5-@:+D99RGK_\RfcSehVhkZjm[kn\lo]mp`mq`mq`mqanrbosbosbosdqu`ruasvasvcuxfvygwzjz}l|o|tz}~~}}||}}}|{{}|{zxwwwwvtsrrsssrv~v~u}u}u}t|o{nzmymymynzo|o|mzlyhygx_y]wVqGb{8Q1J}%= 830-+%$"  ~~}}{{{{z{zzzzyxuuuuuuttr q p p p p p p qr q q o ommll k kiiiiiiiihggggge d c c c c c c ` ```_ ^ \ [ZZ W WWWWVTVSU"T&X2P5S!>J#@L)AG+CI1BI0AH0AH0AH/AK.@J0AH0AH2AG2AG0AG0AG0AH0AH1?I1?I1?G1?G1@F2AG2BE2BE2AG1@F1>J1>J5@K6AL6CI6CI7DJ5BH6BJ6BJ4BJ3AI3AK4BL6CI7DJ7DH7DH5EH5EH5EH5EH5EH5EH4FI3EH1FH2GI2GI3HJ5GJ5GJ8HK8HK:GK:GK=HL=HL@HO@HO>HO>HO:IO:IO:IO;JP=JP=JP>HO>HO?IP?IP?IP?IP;JP3bZ?jR;fN;eB:dA7b=6a<5`;3^93\52[44\33[25Z24Y14Y14Y11Y.0X--X+,W*+W'+W'-V)-V).U(.U(/T%/T%0S$1T%.S$.S$.R&-Q%-Q&,P%+Q&*P%*Q$)P#*Q$*Q$+R%*Q$)P!(O (O"(O")O$)O$)O$)O$)O$(N#)N)N.N"-M!.M#.M#+L"*K!&L!&L!'M"%K 'K 'K )I"(H!(H!(H!(H!(H!'G 'G 'G!'G!)F!)F!-F!+D(D)E%E&F!E! D $C #B$B$B$B$B$B#A#A"@ = =>?@?=><< : :8 8 766543335654100///----,,++++++* * )"*#+ ,!/#1%3( 7,!84%<8#<8%>:=TPI`\Xih[lkXljYmk[lk]nm]nm_pobprbprbosboscptdqucsveuxeuxfvydvyfx{l|n~qtvz~~~~}|{{{{zzzzzz||yxwwxxutstuutrt~s}u|u|t{t{pynwlxmykym{lzlzmylxlxlxfydwawYoLdD\~/I,F}%= 831+)%$#! } } } { {{{{{zzyyvvttttttttr q q qr q q q q q q q o omm k kl k i iiiiiiigggggg d d ` ``aa```__ \ \ \ [ Y Y W W WXXWTW U$Y0T3W=M!?O$BJ%CK-DF-DF1BH0AG/BI.AH.@J.@J.@J/AK/CH/CH-CH-CH,BG+AF-?I-?I+@G+@G+BD,CE,CE+BD/@F/@F2@J3AK5AI5AI6CI5BH5BH5BH3AI3AI2CJ1BI/AL/AL1AK2BL3DJ3DJ1EJ1EJ1FH2GI2GI1FH1FH1FH/FH0GI0GI0GI1HJ0GI5GJ5GJ7FL7FL:FN;GO=GO=GO>HP>HP=IQHO?IP;IQ;IQ;IQ;IQIT>HU>HUۡl~)PJ2YS=iU/`<1^90]83]41[23[23[23[22Z11Y.0X--X+,W*+V)+V)-V),U(-T'-T'-T%,S$/T%.S$.R&.R&-Q%,P$+R%+R%+R%+R%+Q&*P%*P%+Q&+R#*Q")Q (P(O )P!'O$'O$'O$'O$)P#(O",N",N",N",N".N".N"+L"*K!(K#(K#(K#(K#'J"'J"'J"'J"'J"&I!%H %H %G!%G!'F#'F#(G$'F#(F'E%D%D$E%F"F"C!B A"D"D$D#C"B"B#A"@?>A@?><= ; ; : :976555322256442100/0--++,,+++, ++*"+#+!,"-#/%1%3'6/ 81$:8)?=%=C-EKJboPhu^su\qsZqsZqsXqsXqs_pv^ou_pv`qw`qwarxbtwdvydvydvyewzfx{gy|j|mqwxxx~~~{{}|zy{|{{z|{{z|yxwxvvutt~t~u}u}t|rzoynxlylymzo|n{n{lxlxlxkwgxfw`vbx^tYoK`@Ux,B~%;w750.*(%%!       ~ }~ } { { { {{{{{{{zzy xuutttttutt q p p p p p p p p p m mll k kkkiiiiiiiigghgggee c b ` `a```_ ^ \ [ [ [ Y Y W WVYUV W#Z.V2Z;S=U AM!BN'DI(EJ.DI-CH/DF.CE.BG.BG,AJ,AJ,AJ.CL.CJ-BI.CJ,AH-BI,AH*BH*BH(CG(CG(CG(CG(BH'AG,?F.AH3AI3AI3BH3BH4BJ4BJ0@J0@J0?K1@L/AL/AL.BM-AL.CL/DM/EJ/EJ/EJ/EJ3EH3EH3EH3EH/FH/FH/GG0HH0HH0HH2GI2GI5GJ5GJ6EK7FL8FN9GO;GO;GO=GO>HP>HO=GN4a<3a91_74_33^22]02]03\/3\//Z-.Y,-X,,W+-V)-V)-V),U(-T'-T'-T',S&,S&,S&,S$,S$+R%+R%+R%+R%+Q&*P%*P%*P%+Q&+Q&+R#*Q")R)R)Q )Q )P!)P!)P#)P#+P!+P!,O ,O ,N",N",M#+L"+K$*J#*J#*J#(K#'J"'J"'J"%J"%J"%J"$I!#H #H #G!#G!#G##G##G##G#&F#C#C$D#F$G#E"D#B#B$D$D$D"B C CBAAA @> >=!<!< <;9877655655544433100000..-,,,,,,,+ + -"-"-#.$1%2&4( 7+"80&<4)@<+B>=TVMdfl|jzewzasv`uv^st^su_tvbtwbtwbtwbtwcuxdvyfvyfvygwzhx{iy|k{~p~o}orstww|~~~~}~~||~}zz||{{}}{yy{zwvtvvvx{|vtttv~xywv~u}q~srp}rrq{oynxnxlylyn{p}mzp}lxlxkwjvixixewewhzi{hwapLa?Tw-H)D}:7}0.,*''% #     }||}{z{{{z{{zzwvuvuuuuuut s p o p p p p p p n m m mll k kiiiiiiiiiihiggggee b b````__ \ \ \ [ [ [Z Y W WUYU Z,U 3\#=R&@U(BO)CP-CN,BM/DK/DK/EJ/EJ0EG0EG.EG.EG.CJ.CJ/DK.CJ.CJ/DK/EJ/EJ-FJ,EI-FJ,EI,EG+DF+DF+DF.DI.DI2CI3DJ3DJ2CI3DJ2CI0CJ0CJ.CJ.CJ.CL/DM/DM/DM.CJ/DK)GH)GH'GH'GH+GH+GH/EJ/EJ0FK/EJ/FH0GI0GI0GI0GI0GI7GJ8HK7GJ8HK7IL7IL7HO7HO9GO9GO9GO:HP:IO9HN;HN;HN9GO:HP7JQ7JQ7JQ7JQ;IQ;IQ;IS;IS;IQ"= ;":":#;#;777766565544432322110/.-- ,....- - - - /"/"0%1&1)3+!7/#91%=5)A91HD;RNMbc_tuh}dy{_sx`ty`sz^qxbpzcq{es{cqydrzcqygs{gs{hrzhrziszjt{mvzox|qz~py}oz~p{n{o|oortssrrvvwvsuyxyyyyz|z{zxvwwwzz~|}zzzzzxz|}|y{||||}{wxyyy{~}~|zxz|yxzzzz{}|~~~yzzz{zwy|yxyxyxxxx|ywwyxywssuvttssqssrturqq~rsq~o}o}o}n|ts~uun|lzm{m{o{r~t}qzq{pzpypykylzlzm{oynxmwmwluluoxpymultisisgtgthv~ft|fsfshrkukwiuXkQdz=W7Qy'F ?z75/-*(&$!   ~~~~}zy|{{{{zyyyxvvttttttrrpommmmppoo lml k k kiiiigghgggghgg d d d d b b````_ ^ \ \ [ [[[[[W VV"\".X%1[#;U&>X)FR(EQ-CN.DO.DO.DO0EN0EN0FK0FK/FH/FH/FH/FH0FK0FK0EL/DK0FK0FK0FK0FK0EL0EL0EL/DK/FH/FH/FH/FH1FH2GI4EK5FL2FK1EJ0FK/EJ/EJ/EJ.GK.GK+EK,FL.FL.FL1FH1FH,HI-IJ)IJ(HI-IJ-IJ1GL1GL4HM3GL1HJ2IK2IK2IK4HM4HM7IL8JM6KM7LN7KP7KP8HR9IS9JP9JP7LN7LN9KN9KN;KN;KN9KN:LO7NP7NP7NP6MO9MR9MR=KULT2b<1a;0`:/_90^6.\4/[2.Z1/Y0-W.-U,-U,/T,/T,/U*/U*/U*.T).T).T).U(.U(1T%/R#1T%1T%+S(+S(+S(*R'+U%*T$-T',S&-Q&-Q&-P(-P(+Q&*P%+Q&+Q&,P%,P%,P%+O$-N$,M#.M#.M#.L%.L%)L$)L$)L$(K#(J$(J$*I&*I&*I&)H%'I#&H"&H"&H"&H"%G!%H &I!%H $G#F$G'G &F'D%B&C&C&C%B"B"B"B"B#@#@#@#@#@"?#=!;#;":"9"988888888774233343200//.-/.. . . . 0"0"0"0"1$2%1)3+3/62 :3#=6(C:.I@6OKIb^]pq`stbqpcrqfrtdprfosenrfosfoshnshnshnuhnulmulmunkuolvlmumnvnpuoqvoqvprwptyptyjt|jt|hu{hu{lv}mw~jv~iu}ht|lxoz~p{oyoyjxlzl{l{kzl{l{m|p|p|p}q~q~mz~gv|m|k~j}hzgym~m~i}ey~h{k~h{gzo}lzjwmzlzo}p~m{ezg|i~km}l|qp~lzn|rn|nzr~ttttqo}o}rrqrrqsro}lzm{rqn|o}qqrqn|o}qrr~srrrqp|q}o}o}qqn|n|n|o}o}p~q|p{q|q|m{m{n|m{ozp{nznzlzlzm{m{m{lzlzlzlzkykzl{lzjxixixhwhwgwgwkyiwjv~iu}hu{iv|hvgubt~as}ft~ft~fsfsiths~js~js~jrykszkr{ls|mszkqxqrzqrzmoymoymoymoyqmzqmzqmzqmzjoxjoxjoxjoxkmykmyhlxhlxekwekw`my^kwRg}K`v=R{5Js+A}'=y74~.,(%$"!!##~ |}}|{ y|{ z z{{yyw vvvttttr qr qopmmmmmnmmlll k k kiihiiiiiggeeeegg d d ` ```__ \] \] \ \ \]\]WX,U4],B\+A[,FS,FS/HR.GQ/FO/FO0GP1HQ0GP/FO/FO/FO/GM/GM.FL/GM0HN0HN/GM/GM2HM2HM2HM2HM1FO1FO2GP1FO1FM1FM1HJ1HJ3HJ4IK5FL6GM5FL4EK1GL1GL.GK/HL.IM.IM-GM-GM2GP2GP3GL3GL/JN/JN*JK*JK.IM/JN5HO5HO7IL7IL3JL3JL3IN4JO6JO6JO9JP9JP9KN9KN9JP9JP;JP;JP9JP9JP6LQ5KP6MO6MOOV>OVOUvvtrm~nrrs}pzt~{usmnsqwt~pzvvvywxxsq}n{rp|jvn{wv~s{t~t~j{m~qm~rtnk|ki}fzkqp~q~tyy{xrk{~`tlZnfSl[OhWHiNGhMAhH?fF=eB;a=6a<5`;4`82^62\31[23W10T.2T.1S-2U-2U-0U-/T,/T,/T,.S+.S+/U*.T)1T%0S$1T$2U%.U(/V).U(.U(-T%-T%-T%-T%,R'+Q&-P(-P(-Q&-Q&-R#.S$/R#/R#0P$/O#.N".N".M#.M#,L%+K$*M%*M%*M%)L$)L$)L$+K$*J#-J',I&-J%,I$,I$+H#*H!*H!*H!*H!*H!)G )G )G )G (F'D&C&D&D$D"B$B#A$A#@#@#@#@#@#@!>#>"=$=#<#;#;!: 999987766542232110000..../ / / / / 1"0$1%2&3' 4,"6.!60$93%=6+C<1HD:QMDYZTijXmoUjlVhkUgjYflXekYemZfnZfnZfnZep\gr`fs`fsbesbesdesdescgscgsagsagsagtbhuagtagtahq`gpbjqbjqbirbirajuaju`itbkvcmucmucnrcnr_mu_mu]nu^ov_nt_ntbnvbnvbnvbnvdnu`jqbosbos`nvbpx_pw^ov^nx^nx_oy_oy`ou`ou`oudsyetzcrxcq{cq{bo{bo{`o{ap|^qx^qx\nx\nx`o{bq}ap|`o{aq{aq{bszbszes{drzdsyfu{jt{jt{kvzjuyitxhswerxgtzht|ht|hs~hs~eqyht|ht|ht|frzfrzgs{gs{dr|es}ft|ft|fvyfvygtxhuyjuyjuyht|gs{fu{fu{gv|etzfrzfrzfrzgs{drzdrzes{drzdrzdrzdr|cq{cq{bpzcqybpxbpxbpxbpzcq{aoyaoy`nv`nvaowaow`nv`nv`nx`nx_lx`my`nv_mu`nv`nv_mw`nx`my_lxZlvYkuWluWlu^my^my`jw`jw^it^it\jr\jrYhtZiu[ht\iu^hu^hu`hu`hubiybiydjwbhucivdjwchxchxcivcivcivagtbgwbgwdgwdgwdgwdgwchxafvafvafv`euafv^eu^eu\fs[erYetXdsRdvOasG_yC[u9Qy3Ks+A}(>z&6}%5|!- ,)''~'~'}&|!| z}~}yyyy{zzzzzvvuutur q q qqqopmmmmnmmmll k kiiiiiiiihggggggggge d a ` ` `__ \ \ \]]][]Y$^.W$5^%AV%AV+HR,IS5JS4IR8IP7HO4GN4GN1IO2JP2JP1IO1IO0HN3HO2GN3HO3HO2GP1FO2GN3HO5JL4IK7HN7HN9GQ8FP9GQ9GQ6GN6GN5GJ6HK6HK7IL7IL6HK6GM6GM4IK4IK4IK4IK4HM4HM4GN5HO7GQ7GQ7HO7HO5HO4GN3HO2GN5IN6JO:JM:JM:JM:JM:IO:IO:HP;IQ;JP;JP9JP9JP7KP7KP;JP;JP>KQ=JP=JP=JP;IQhL!> =<<;:98667755443332000///. . / 0!0!1"0$1%2'3(4)6+7092"=4%@7$@;'C>-ID7SNE[YCYWFWXGXYKVZLW[LU`KT_MXcMXcLZbJX`OXcQZeVXbWYc\YcYV`YW][Y_ZY]ZY]ZX^[Y_\YcZWaYUbZVc[Xb\Yc^[e]Zd^[e^[e^[e_\fZ\fZ\fV_jT]hS]jU_lR_kQ^jP]iQ^jT^kU_lX`mW_lU`kValT^kU_lValU`kV`mV`mTamVcoSbnRamScmScmTblTblX`mYanYanZboYdoWbmUbnR_kQcnQcnQcnSepVcoWdpYetYetXeqWdpSbnUdpQepQepRdnPblUgjVhk]fqZcneblebljcjjcjgekfdj`en_dm\cl^en^fm`hoZhpXfn\bn]co]bk_dm_eq_eqbhmaglhflhflhflhflgekhfl`ho`ho_ip^hodfkdfkgekgek^fm^fmZhpYgoZhpZhpYgoYgoUflUflUhoTgnNclOdmRcjTelYgqYgqYfrZgsTcoTcoVdlVdlYfrXeqWfrXgsWdpVcoYcpXboTamUbnUbnTamTamTamNaoNaoLbmLbmPdoSgrVcoUbn^`l^`lcagcagabjabjabjabjeblebldakdakZ`mZ`m[anZ`m``j``jc`ic`ic`jebl^bn\`l]_i^`jc`jc`jc`jdakcagb`f`]f`]f]^f]^f\_g]`hZ`gY_fV^eW_fU_gU_gRamP_k@WmX*@Z'ES(FT0IR0IR:IO9HN;HN;HN7FL8GM4HM4HM4HM4HM4GN4GN2GP3HQ2GN2GN3GL3GL5GJ6HK8IJ8IJ7GJ8HKIM>IM=GN>HO?HS?HSAGSAGSAHQAHQBIRCJSBHTCIUCKRBJQAKRBLSCMTBLSBLTBLTBKVBKVAKRAKRALPCNRBLSBLSCMUCMU 5/ # "             #   #%""#%!!  %%$*)/*+/0/,!1.$;0(?4+Q;6\F?gQ@hR?hP=fN3%@7#>51*-&3/73%9>+0#+(0%0$/%1". &3%+8&.;'4!)6$,9!(9%,=%,= '8 )4 )4 *2!+3"(5#)6&->$+<"+<#,="):"):$+<#*;$,@#+?#.?(3D&2A#/>$/@!,=#.A(3F&5I /C%2E!.A$/B*5H'0A$->(1B-6G,7H)4E(3F)4G+6N,7O&7K):N':H2@'6B&5A+9I+9I)8L*9M(:L);M*=K':H!7D#9F)>M'W+;R-=T+?Q';M&;J$9H)=H.BM,?M(;I'=J(>K+@O0ET4FX/AS+=M(:J*=K+>L-CP.DQ(AK&?I%=J*BO/DS-BQ,EV)BS)@O(?N-?O/AQ3AQ3AQ5@QFZ=HY>IZIZY0BR1CS4FQ3EP8FP8FPJR>JR?JU?JUTbjR`hVdfZhj\ig\igXgf\kj_nm^mlZkjYjiWhiUfgTefVghPegNceMdfNegOadQcfScfP`cP`cM]`L\_JZ]H[bH[bG[`CW\CXZCXZDW^AT[EV]GX_BTW>PSG#>H$?I+DM%>G$<<&>>&fJ>dF=cE;c@9a>9_;7]96^55]41[21[2/[2.Z10X//W./W..V-0V+0V+0V+/U*/U*/U*/V)/V)/V)/V)/V).U(.U&.U&.U&.U&.U&-T%,S&,S&-T'.U(.U(-T'+S(*R')Q&(P%(P''O&)N&*O')N&)N&)O$)O$)O$)O$*M%*M%.K&,I$+J *I+K,L +K$+K$*J$*J$)J')J''H%%F##G##G##G##G##G#"F"&E"%D!&C &C &C %B$A#@!@!@@@@@ @! @! ?">!>!= <";! 9! 9!99 7 7665 5 3 3 222211123 20$1%1%1%2&2&1'2(!5+#7- 9.";0%>3";0)# %52/=E-5/A/A-8.9-8.91;,6.84>*8(6!/? .>'9,>"8K$:M-CP!7D+6!5@/C,@.A!0C 0@$4D0B0B 3G0D1G.D-?2D/B3F->,=0F(>3M3M6G6G0>!;I#9D/:3E2D3?/;-@+>3M7Q4G5H4E+<*7+82@/=/B2E9K0B/?0@/?5E0B (:,F(B(B+E)B#<&@*D.C0E0B ); (? (?,C (? &; )>,C.E,E,E/H+D)>.C)< !4 3 3 /3'6*9/B)<: 565159;#? <:: 1,&(!0./20-.!4!42. / /"102/,) -.!1*)' )!1"2!64./01"4101,!.%2 -** '!('"*)( %# % % % %!&!&!"*!"*! -* "' "'!%!% $ $ $!%!% $ %!&!& % $!%#&!$!#!#!# ""$#%"&"&!$!$"%"%"%"%#($)%)%)$,$, 5#8"S%Vff rv()*}({&}%|%{$z#y#y!y xzyyxw uwwuuuutt rsonnnn mll kliiiiiiiiiihhfffeeed cbc ab ab Z X F B / / &'&'&' &"((4(5A/;J-9H*7C)6B*8B,:D,9E(5A)5D*6E(9G%6D%7B%7B%7B);F+! ?" >$ >$ >%=$=#;!<#<#9%9%8$7#5"5"7"6!5"4!3$3$2#2#3"2!1223 3 3 3#3#3&4'1)2*4,5-7092!;4#=6$93%kkkw~ywwwxvuyurv~zrwyrxxtvwxwwxxwyxyvsqrtusvup~uwl~qprwsppnnoi|n}po}m{o}m{kyo}rpp~p~n~jzjykzhzk}dxdxlfyeyeydxeyhxgwhwix`v^t\u^waw]s~dsfudsbq}^r}_s~^r}Vju\nybtXmvWlu_q|_q|_lxanzbpz`nx`my_lxXeqZgs^kwZgsRamSbnRbrVfvUftPaoR`oR`oTamS`lR_kS`lRfqThsPdoNbmK_jJ^iIZhGXfFTdHVfJUfMXiS^oMXiOXiPYjNXgQ[jOYfJTaGT`HUaFUaET`EV]DU\O$?P">L'CQ ANN%7G,7!3>$6F"4D-=+;/F/F-A!5':,?,E*C*A&=#; 8 :9<$A!)K$,N .X'5_%i!eliqr|$'}'}'}'}({)|({&y!x!xyyz x x yvvrr t ttsrqqoo m l l k kiiijiiiihhfeeeeefeeecc`_ [ Y B 9 "*!,*=)4G 3A0>0>.<-?.@0C1D/B/B/A/A/>3B1>+8/:"8C3=0:2?2?1>2?0;1<.A%4G0@P1AQ0AO.?M1AK0@J1BI0AH.CL/DM/CN/CN/CN/CN/AK.@J0>H/=G2?E1>D2?C3@D2?C2?C4?C4?C5?F4>E4>E3=D4>E4>E6?B7@C8>C8>C5>B5>B6?B6?B7@C6?B7?F6>E8>C8>C9?F:@G6CG5BF3AK4BL5AP6BQ7DP9FR2HS.DO+DN&?I3>#7B%=J(@M7C7C"9H6E%7I*!@#!?%!?% >$=#<"=#!<$ ;#:&9%9%8$6!7"!6# 5" 4$3#2$2$2$2$2"1!223 3 4!4!3$3$4%6'6+ 7,7/ 80!<3#>5%@78/  6A?~վ׻ѩѽοѿпҾѻѻѺмҾӻллкϺϿѿѾϻ̹̿ҽμͼͷʺ͹̺ͻι̺ͷʷ̻и͸ͷ͸θζ̷͵˵ʸͷʹ̷͵˳˶ε̳ʳʲɵʸͶ˰ůĴɵʲDzǴɴɲǵʵʳȳȮŰǮưȮůƳƱIJűį¯¯ĬİůİŰűƱƮì¯įūĭì­Ŭįǫê­Ūy`y8Qu(m d i hlou&-,~({%x%z$y${"y w w w w w wsrtsrqppnnnmnn m j i ilk i h i i e eeddecdedbaZ U > 9  'ADLlp||uh|VjuPbrUgwUjsTirVktWluWkvXlwPfqLbmNfsPhuOhrOhrTfqQcnWemZhpXhkZjmVjoUinRgpPenOdmQfoPelShoVeqXgs[cpDLY5BN2?K.>H.>H.>H1AK.EN0GP.GP-FO0EN/DM2BL-=G(7C&5A(5A)6B+5D+5D)5D(4C)4E)4E-4E,3D,4A,4A-6A+4?+4?+4?,2?,2?(/?)0@%1@%1@*1A*1A*1A*1A,2?-3@-6A09D/=E/=E/;J/;J1?O3AQ4HS;OZH^iQgrXqsYrtYot[qv`u~`u~avf{hzhznmk~pxx~}«Űʷ̺ϼѺϹмӹҷйԷҵζϷзййкѼӾӿԽԼӽԽԾ׼ս־׼ػ׼ػ׻ּ׿ֽԽԾսԾվվսԼӼռվ׼ջԾ׿ؾ׾׿ؽؽزԠ}b.iePLP=aN1jP0iO6gJ4eH7dE7dE9c@9c@9a>9a>8`<7_;5^73\53Z33Z32Y22Y2-X3.Y4-X3,W2,T0,T0,W*,W*,W*+V).V+/W,3W,3W,2V*1U).U(-T'-T'.U(.U(.U(/S-.R,0R,/Q+.Q)-P(0O%1P&1O(1O(/N+.M*.M*.M*-L)-L)+L)*K()J'(I&*I&,K(,L&+K%*J$*J$&J&&J&$F'$F'%E&%E&%F$%F$#F$#F$#F$"E#$D%$D%%B%$A$!@#!@#A"A"@!@!?"@#!?%!?% >$=#=$=$!<$!<$;':&:$9#7"7"6#6#6%6%3'3'2&2&4!4!5 5 4!4!3$3$4%5&6)9,7/7/":2$<4%@7#>51*CLH̸˸˹̸˸˶ɶɹ̷̹̹ʴǵȷʷʷʸ͹γʪƶγȳȳȳȵȵȳƵȵȴǵʴɵʴɵ˵˴ʵ˵ʳȰǯƭɭɯ˯˯ɭǯDZɯƯƱƳȱİñijƵȴǰðï°ï°ðŰųȯĭįƮƭūŮȫĩ«ūŬƫŨĪé«īĩ©¨è©è«ŪĦ¨v^yGb5K-Cx/p a fl o ooo u$y(z'y'y&x%w$v%u%u#r"q srsrrpmn m l m kkjjjk i h hiif d c cba_ ^ZZ LF :B(+H:=ZDMQQZ^mvzx`tUitZnyZqsZqsZpu]sx\rw]sxXnsVlqVntXpvWouXpv\puYmr]mp_or^nq_or\qs\qsYprXoqXoqXoqZrrZrr]orasvZdk?IP4=H3J4CO5OU=W]IhmSrwXvwXvw[wx\xy`y{_xz`y{e~hf}jjlpstyyty||ƪŭȯʰ˰ͰͭͮήЭϬ̫˫ʫʭʭʭ˭˰̰̮ˮˮ˯̯ϮήϯЭϭϭϭϮЮЯϯϯϯϮήά̬̬ˬˬˬˮ̭˭ͭͯϭͭͮί̯ͮͯͯϳӱ֬љƆb:msMELD&bM-iT2iO/fL5cH5cH8cD8cD8aA8aA9`@7^>8^:5[74Z63Y5/Z5/Z5-Z5-Z5/W4.V3,T0,T0+W.*V-*V-*V--W..X/0X/0X/1V./T,/T,.S+.T)-S(.T).T)/T,.S+.S+.S+-R*-R*0P)/O(/O(/O(-O)-O)-P(-P(+N&+N&)M)(L((L('K'+L*+L**K(*K(&J&&J&%H&%H&%H&$G%'D&'D&%E&%E&"E##F$#F$"E#"D%"D%"C&!B%!B% A$C%B$A#A#@#@#@%?$?$?$=$>%>%=$;':&:$9#9#9#6# 7$6#6#5&4%4%3$5!5!5!5!5!6"5(5(7+8,9+:,!:/#<1$?4%@5'C<1*  <,.ļϽγĪª§§­ūéìĬĩªĦ¦¦¤£££¤xgJo1Vx.fVYZ Z\chs!v){){+u,v,r,r*s(q#s"r"t!s"t r !p !p!q p p nll ij i g h iiighe b_ ] M G / +  (+9OR`hozthToyLbmTjuTmqTmqVkrWlsWlsVkrUjsUjsTirUjsUjsTirTirTirTjoTjoVjoVjoTjoTjoRkoRkoRkoRkoRkoQjnXjtYkuBPZ/=G+8D.;G-D.BM3GR;T]E^gKiqOmuPnvQowRqvSrwVsxXuzYvz[x|\z{]{|_|`}bcjkmnnort©Ȭʭ˯˲δвΰαϰΰί̮̭ͮ˯ͯͯͯͮ˯̯̯̯̯̱ϱϱϲаѰѰѰѰаЯͰββαͱ̯ͮͮˮ˰Ͱ̮̮̰ͯͮΰίͯͰΰΰΰίͰβҳӭԣʉuH~TX C:QH-bM1fQ9eJ7cH;dE:cD;bB:aA;`@:_?8];6[96]65\53Z33Z33Y53Y51W30V21U11U1/W./W./W./W.0X/0X/0X/0X/0X/.V--U,-U,,T+,T+*T+*T++U,*T+*T+*T+,T++S*,Q)-R*0P)0P)/O(/O(/O).N(,M*+L))M)(L((K)(K))L*(K)'K''K'(I&(I&%H&%H&$F'$F'%F$%F$%F$%F$#E&"D%"D%#E&#D'#D'#D'"C& D&C%C%C%B$A#@#@#?$?$ >$ >$=$ >% =' ='<&<&<#;"9$9$!8%!8% 7$ 7$6%6%5$5$6%5$6#6#6%8'8+9,8-9.9.:/%>3'@5-A9.B:  osrȼʵí쩨¨¨¨¨¦ëĬŬŬŬŬūīëë訩ééé訨¨tc{ZrD\)Ah"_ Y ] Z W W WZ_`gekl hn on#n$o$o "m"n e f fdeb _ \ Z Q N@ > 1 2 13E"&M13_@Bnkn~ulUitPblZlvYnpYnpYmrYmr\lv[ku\iu[ht\iu\iuXjtXjtXkrWjqWjqWjqVipVipVjoWkpVjoWkpUjqUjqTipRgnYjqJ[b/=E/=E/%?&?&?&!?&!?&!>(!>(!=) <(<(;';';':&:&9(9(8$8$8$8$6'6'7( 8)8(9):*:*:- 9$A8#@770 $.75hea̳ɮĪĪĨĨĩŨĩũŨǦţ£§ĨŪª¬ŬŬŬũ©êĩéëīĩĩĪŪũĩĦ§æ¦¥§vod|Ld~3Gn*>e+8e'4a%0]#.[)X%T URZ[ \X Y\a _ ^ ] U S NOO M I H=C"+C"+C'.7)0917D>DQ<@aCGhos{~yqXipRci\msYnpZoqZmtZmtZlvYkuZiuZiuZiuYhtXjuXjuXjuWitWisWisXhrYisWjqWjqVlqVlqVkrUjqTirUjsM[e?MW+6A/:E1( <( <(;';':):);':&:&9%9'9'8(9)!9*!9*!9*!9*;+<, 1#>3%@5'B9)D;*@8*"  AFAýͿϵŬƫŪīūūūūūŬƬƫŧŦĦ¦¨¨¬ĭŬĬĬ¬¬¬¬¬¬ĬīëìŬūīī©¨¨¨§|ph~ZrQiBXx:Pp;Py9Nw)?l5b/_/_!1c.` *Y'V,T*R#-V,6_3:e/6a/2\;>h?KhP\yo{tw}zrXioRdg\nqZoqYnpZmtZmtYlsYls[ku[kuZjtZjtWluWluVktVktUjqUjqWjqWjqUjqUjqTmqTmqTmqSlpUjqTipAOW3AI0;F10[9-iG1dH1dH7bC7bC9_A8^@9]?7[=8\88\85[74Z63Y52X44X43W32V22V20V20V21W32X42Y21X1/W./W..V-.V-+U,+U,+U,+U,-U,-U,-T--T-*V.*V.*U0*U0-S/,R.*P,*P,,P,*N**N*)M))M))M))L*)L*)M)(L(*K()J'+J'*I&)H%)H%'H%'H%'H&'H&%F)$E($E(#D'#E&#E&%E&%E&%E&%E&#D'#D'!B%!B%#B%"A$#C$#C$"A$#B%#A'#A'#A'#A'!A(!A( ?) ?)>(>(<(<(<(;';';';';':):)":+#;,$<-$<-!>."?/#?2$@3&A6)D9+D9-""-94bniοδɯĭǭǬƬƩũŪƪƬƬƬǭȫǫǩŨīŬƫŬƭîĭíëūūŪĩĩĬŬŬŬŬĬĬ¬ªª©éééé訨¨¨¨}vv~|xx{z||rVgnPegZoqZoqZoqXmtXmtWlsXmtYkuYku[ku\lv\mt[lsYlsYlsXkrWjqVkrVkrWlsVkrVkrVkrVkrUjqWkpRfk5DJ&5;4>F3=E3BH6EK6KM8MO:OV;PW;PY;PY:OX8MV6KR3HO5DJ,;A*4;'18'26(37$56#45#52"41#30#30"02!/1!,0 +/$+.#*-%+*%+*&*)$('$&*#%)%%&%%&%%%&&&&&&'''%*-(-0'35-9;-=@/?B3DJ;LRI\cVipXkrZmtZovZovYpyZqz\tz]u{^v|`x~dyf{g|h}g~ijkkmpquvvvĪȬ̮ΰѰѰвҲҲұѱѱѱѱѱѱѱѯѯѯѯѯѯѱϱϱααѰгѳѲвввввбϱϰбѰаввбϱϲѲѲѲѱϱϯЮϯЯЮήή̯̯̬̯ͮͬͳѽٸԧΙuX+bb DD J9UD+aI.dL6cK4aI6`D5_C8^@7]?7^>6]=5\<3Z:1X81X83X82W72W51V4.V2.V21Y01Y02Z11Y00X//W.,W+-X,*X*+Y++W.+W.,U.,U.+S/,T0,T0,T0,T0,T0-S/,R.*P,)O+*Q*)P)*N*)M))M))M))M))M))M))M)(J+(J+'H+'H+'H+&G*&G*&G*%F)%F)&G*$E($E($E($F'#E&%D'%D'%C)%C)!D)!D)!D)!D) C(B'"B)"B)"B)"B) B) B)!C, B+ A, A,@+ A,@+?*?*>)=)=)!=)!=)!<,!<,;.;. 2"@4A4B5 E8 E8#C>"B=/+ '#ulmѹ̴ǬƬƫǫǫȪǫƪŬǭȭȭȬǭȭȬǫŬƬǬǬƬƬĬĬĬĬƫūƫƩĪŪũĬŬŬĬĬ­ëŪĪŪŨŨŦĤ¥ä¤¤§ç榨¨¨¥¤¥¤~xkQgrG`iTmvVosVosWouVntUmsUmsWluVkt]jv]jv]ks]ks\jr]ksYlsYlsWluVktVktVktVktVktVktWluZhpLZb9=I/3?7;G9=I7DH&1<'18)3:)57*68&54%43%35%35"25 03/2/2"-1!,0#,/ ),$),"'*"&+"&+$&+$&+#%)$&*$&*')-%,/+25'89+<=+CC/GG1LP?Z^KdnRkuXmtYnu[pw[pwXqzZs|\u~\u~^w_xazb{h}i~i~klmnqrsuwvwèĭɳϱͱϳѳѳѲввввҲҲұѱѱѯѯѯѯѯѯѲұѱϱϳϲΰааΰαϰαϱϱѱѱѰвѲѲѲѱбвѲѳҲѲѱЯϯϮήήήαϰΰΰαͰ̯˯˴ҷչڶצ͑v[NL64B-#VA9^>3\=2[<0Y:0Y:1X81X80X40X4/W3/W33W13W13W12V02W/2W/0X//W.0X/0X/0X/0X//V//V/1U10T00T00T00T00T0-U,,T+*Q**Q**Q*)P))P)(O()M))M))M))M))L*)L*)L*)L*(J+'I*)H+)H+)G-)G-&G,%F+%F)%F)$F'$F'(E'(E''D'(E(&D*&D*"E*!D)!D)"E*#C*#C*'A,'A,%B,$A+#A-#A-#A-#A-#A-"@,"@,!?+"@,!?+ >* >*">*#?+#?+#?+#?+$@,"?/"?/%?2&@3'?7(@8)D;)D;+E>)C<+(  &%ҽжɭǭǭǭǭǭǯǮƭƮǮǯȯȯȯȯȮǮǯȮǮƯǯǯǮĮĭŭŬĭŬƬƫŬƫŪīƫƫëëëìĭŪŪŪĪĩ§¨ª©ª§§¥¥{oZnyMalZny[nu[nu[nuZmtXmtXmtYkuYku^kw^kw^lt]ks]ks]ksYlsZmtWlsVkrVktVktVktVktWjqZmtR_e:GM.3<49B5;H8>K9EM=IQ=NU?PWbD?cE>bD<`B9^C8]B5]A4\@0Y?0Y?/Y=/Y=/W;/W;.W7.W74X43W33W33W31W31W31X10W00X/0X/2V22V22V21U11U11U11U10T0/S//S//S/.R.)Q-(P,)Q-(P,)O+(N**M+*M+*N**N**M+)L*)J-)J-)J/)J/(I.(I.(I.(I.(I.&G,%F+$E*'F)'F))F))F)'F)'F)%F+&G,#F+#F+#E,$F-%D.%D.)C.(B-'A,'A,#A-$B.$B.#A-#A-#A-"@,#A-#A-"@,"@,"@,"@,#A-#A-#A-#A/#A/#@0%B2(B5)C6*B;,D=,F?)C<3/($*(STQѿγɰƭǮȭǭǯǯǮƭŭŭŮƯǯǯǯǯǮįůůůůůǮƯůůůŭǭǭǭǬǭȩƩƪƪƬĬīëêīūŪĪĪĪª¨¨§çççééè©è¨¨§ªªªªª¨¨§~xpXlwSep\ny[nuZmt[nuZmt[mwZlvZlvZlv]mw\lv^lv^lv^lt^ltZmtZmtXmtWlsWluWluVkrVkrXjmUgjJUY,7;17<7=B6@G9CJ9IL>NQ=PW>QX=R[=R[=R[>S\;TX:SW6QU2MQ0FK)?D)8>'6<*59,7;/8<.7;+6:+6:(59&37#36"25!14/2!-5 ,4!+2)0#)."(-&(-&(-%',%',)'-*(.)+0+-2,3618;/?<4DA7KI@TRG]bUkpUjsXmv\pu\pu^qx_ryZs|\u~Zw|\y~bzd|d|e}egfgfghinptuxz׾׾׺ѺѺѺѵдϵѵѵӴҵӵӲҲұҲӱҰѯϰЮήήήήήΰΰαϱϱѱѱҰѳҳҳѲввввбϱϱϱϱϰΰίͯͯͯʯʯͯͯͯͯͯͯͯͰβеӷխҧ̇rO}MT%60&O72[C7dG6cF6`D5_C4^B3]A2\@1[?1\=0[<.Y:.Y:-Y8-Y8/X8.W70W70W71X80W72X41W31W31W33W33W32V21U11U11U11U10T0/S//S/.R.-Q-)Q-)Q-(S.'R-*O-)N,)N,)N,)N,'L*'L*'L*'L,'L,'K-'K-)J-)J-)J-(I,)J/'H-&G,%F+'F)'F)'F)'F)%F)%F)&G*&G*&G,&G,&F-&F-&E/&E/'D.'D.&D+&D+&D+'E,$D+#C*!C,!C,B-B-!B-!B-!B-!B-!B-!B- B0 B0"A1#B2$C3&E5)E8*F9,G>.I@)C<,%  $ pllԶ˰ŭǭǮȮȮȮȭǭǭǬƮƯǯǯǯŰưƯŭŭŭǭǭǭǭǭǭǭǮƯǯǯǭȭȫȫȫȫȪǪǪǪǪǪǪƪƪƩŪŪŪūƨħèŨŨŨŧħĩĩĩĩħħħħĨ©é覦¥§§§~xp[pyTfq\ny^nx]mw]mw]mw\kw]lx]lx]lx_lx^kw^lv^lv_nt_ntXmtXmtWluXmvXmvXmvWlsWls[jpM\b?JN'261<@5@D5EH9IL6LQ9OT;PW;PW=RY=RY>SZ?T[)87*98+9;+9;)9<)9<$9;"79!6745!3614 /5.4 -3,2#,/"+.#*-#*-$),$),(*.)+/(-.-23/:82=;0B?5GD9QOC[YJclVoxWluYnw\ov]pwZrx\tz\v|]w}^x~_ya{b|e}f~fgfgiillpqtuxz۾ؿٺظִ׳ֳ֯үѱӲѲѰϭ̳ѳѱѰгӴԴԲҳӳӳԲӳԳԲұѱѰааЯϮΰѯЮϮϭͭͯͯͯίίίίΰϰϯίήͯΰϱԵح֢ˉtKw}!MS 2-+&H03\D:bF9aE6`D4^B3^?3^?1]<0\;0\;/[:.Z9-Y8-Y8-Y8/X8/X8/X8.W71Y60X51Y50X41W31W30V20V2-U1,T0*T1)S0)T/(S.,R.,R.,R.-S/,R.+Q-,O-,O-+M.+M.(M+(M+!M*!M*#M*#M*'K-'K-'K-'K-)K,(J+&J,%I+$H*#G)(H)(H)'G('G('G('G((G*)H+,F*-G+,F,-G-,E-,E-,E-+D,)E+)E+)E+)E+'E,'E,%E,$D+#E."D-#E."D-$D+%E,%C/%C/&D2'E3(E5)F6)G5+I7,I9,I9&?4 7?9xz˷˵ɰȰȰȰȯǯǯǯǭŭůůůįįƮŭŭůůůǯǯǯǭŭŭŭŬĭŭǭǯǯǯǰȭŭŭǭǬǬǮǮǭǭǬƬƬƫūƪūƫƨĨĨĨĪŪŬūīīħçèĨĨħééé覦¦¦¨¨¨¨§{s\kwZhp`nv`nv_mu]lx^my]mw]mw\lv\lv]mw\lv\lv]mw\ms\msXmvXmvXmvXmvXmvWluWjqYlsXgm:IO1=E1=E0?E4CI3HJ7LN:OQ=RTTY?UZ@V[?VX?VX?TV2FD7KI?W]JbhRhsTjuYnuZovZov\qxYsyZtzZw|[x}]z^{a{c}e|g~hjmmpqrrtuwxxzYbe]fiakkkuuo{}z~ģæƨȪʩɦɩ̩Ψͦ˩Ϋͩ˩ɨȮ̮̪ɪɭ˯ͮʪƪȪȩάѱԯүҰӪѱظؼܾڻܿԽҼԹѸһչӷѶжзѴαгүίίίήͮͮͮͯεԳֱԦϝ~c:jqGN;4 @9!O<)WD1^G2_H2_B1^A3]A2\@1[?0Z>/Y=.X<.Y:-X9.Y:-X9/X9/X91W91W93W93W91U71U71T90S8,T8+S7(S4'R3)R2)R2,Q/,Q//S//S//R0.Q/,M0,M0+L/+L/'N.&M-"N-!M,!M,!M,'K-'K-'K-'K-'J/'J/%J/$I.#H-#H-&H)%G(&H)&H)(H)(H))H+)H+-G--G--D1.E2)D3)D3)E1(D0&F-&F-'G.'G.&E/'F0$E0$E0"E0"E0#F1#F1%E3&F4&E5&E5'F6(G7%G='I?&J@#G=:1-$  /5-HNFӽ̴ʱDZɱɱɱɱɱɱɱɰȰȮȮȭǮȮȮȮȮȮɭȯȯȯȯȭǭǭŭŬĭŭǭǭǬƭǭǭȭȭǭǭǭǯǯǯǮƮƮƭŮƭƭƭƬŪŪŪīūūŬĬĪũĩéêĪĩéééé訨¨¨¨¨¨¨§¥§§¦~xpXjuWdp`my`nx_mw\nx\nx[mw[mw[mwZlv\kw]lx\lv\lv\lv\lvXmvXmvXmvXmvWluVktZmtVipK\b!28&5;0?E0BE3EH6KL9NO9OT;QV=R[>S\?T]@U^@U\AV]AW\AW\?T]*7=&69%58$47#36$15"/3$/3#.2"-1"-1#,/#,/#--#--#0.'42'65,;:/=?4BD6GH9JKI_dQglUjsXmvZoxZoxYoz[q|Ztz[u{\v|^x~byczd{e|f}hklmnprrsvxyzyz #%4:(CT2M^6\t@f~GsKwLyP}XZdcirpt|ƪϺ׽ԺԾջٶԱְժΧ˪˫̬̬ͫˬ˪˫̩ΫЭԭԡʒub2jo CH+#+#!H52YF5^F5^F4]C3\B2\@1[?/\?.[>.[<-Z;/[8/[8/Z;.Y:0Y:0Y:4X:3W93W93W91W90V8*U6)T5'U4'U4(T3(T3-R0-R00S10S11R01R0/N1.M0,M0,M0&O/%N.#O."N-%K-%K-%J/&K0(K0(K0'K-'K-'K-'K-'J/&I.&J,%I+'I*(J+(J+'I*)G-)G-)G.*H/*F2+G3)G3)G3)H2(G1(I.(I.'I0'I0&G2&G2%E3%E3&F4&F4'G5'G5'F6(G7*F9+G:)H:+J<'KA)MC$F<1'  MMHѷȲȱDZDZDzȲȲȲȱɱɰȰȱɱɱɱɯǰȯǮƮȮȮȮȱɰȰȰȰȯǭǭǭǭǭǭǯǯǯǯǯǯǯǯǯǯǯǯǯǯǮƮƮƮƮǮǮǭƫƫƫūŮƮƭŭŬĬĬĬĬĬīìĬĬīª¨¨¨¨¨¨¨©~xnThsQcn\ny\nx\nx^ov^ov^ov]nu]nu]nu[mwZlvZlvZlvZlvZlvXmvXmvXmvXmvWlsVkrXmtNcjDSY(7=,9?2?E3CF7GJ9LM;NO>OV@QX@R\AS]@U^AV_BW^BW^BX]BX]AW\>TY>NX8HR1BI,=D*;<):;):9*;:+;>+;>*:=)9<(9:&78(68&46'35&24&15%04$/3"-1".0".0"/."/.'42*75+;8/?;]D4^B3]A3]A2\@2]>1\=0\;0\;0['H:4+ ' ;GAcoi̿ҽеͳ˯ɯɰʰʲʲʰʰʰ˯ʭɮʮʭɮʭɭɮʮʬȭɬȭŮưưƯǰȯȰɮɮɮȮȮȮȰȯǯǯǯǯǯǯǯǯǭǭǭǭǯȮǯȯȯȮǮƮƮƮƮƮƭƭƭŭŭŭŭŬĭŬĬŬŬĬĬ¬¬¬©ééééé訪ª§}qZlwYkv\ny\ov\ov\ov\ov^ov^ov]nu]nu[mw[mw[mwZlvZlvZlvXmvXmvXmtYnuZovWlsVipCV]3AI.PZ>S\@U^AV]CX_CX_DY`DY`EZaCY^AW\CQY':;);8+=:*3DJ:KQ?U`J`kUmsUmsVntXpv[py\qz[r{]t}^u~_vayc{d}e~f}g~hjmmopqrstwxzzy{8EI>KOBSYVgmYpyczmt~Ũɫ̭ήϱҶ׻߼ܹٻ޼n  BHGqd>cp=bo`gijepģǥɦɪͪɪɬ˨ǩȭ̧ƩȬ̰ЪѧΕ„hU%U\&-/")E80ZD1[E+\E+\E-]D-]D0\A/[@/[@.Z?0Y?/X>/X@/X@-Y>,X=,Y<+X;+X9)V7(U6'T5*U6*U6*U6)T5*S3)R2+R2+R2+Q3+Q3-P5,O4,O4,O4-O6+M4)N4(M3&O5$M3$N2"L0(M-'L,)M/(L.*N0*N0*M2)L1)L1(K0(K0'J/'I0(J1(I4*K6*I9*I9)H8)H8&H7&H7%I8&J9&J9'K:'J<&I;$J;%K<%K<&L='M>'M>'M>'M>%LA%LA!E;*  6<4ռ͵˵˲̰ʰ˰˰ʱ˱˱˰ʱˮˮˬʭˬʭˬʫɭʭʭʯ̱ˮȰȰȰȰȰɰɮɮɮɮɯʯʯʮɮɮɮɮɭȭȭȭȫȫȫȫȫȫȭȭȭȭȬƬƮƮƮƮƮǭƭƭƫƬǬǫƫƫƫƫƪŪŬĭūꪪ§èħħħħĨŧħĦè§znUitThsZnyZovZov\ov\ov^ov^ov]mw]mw^nx]mw^lv_mw^kw^kw\kw\kwXmvXmvZoxUjsP_k:IU"17-D2AG1FH5JL6MO9PR;QV?,=>*;A(9?&:?$8='7:&69)3:(29'19&08(/8'.7%04$/3!23#45%:;(=>/?B4DG7HN?PVE[fPfqQjtSlvXnyYozYoz[q|Zs|\u~]w}_yczd{e}f~ghklmooqrrttvwwxwy/EJ6LQ@T_SgrVoy`ymtéŬȯγҵԶչս뫵*61     KQPzvι߷ٮЎyV%QX#$/ %L,3Z:3\B4]C3\D3\D2ZD2ZD1Z@1Z@0Y?/X>.W=/X>-Y>+W<-W;,V:.W8-V7-V7-V7-V7+T5+T4*S3,R4+Q3-Q3.R4-P5-P5-P5-P5+Q3*P2'R3'R3$Q4"O2$N2#M1'N.'N.(M2(M2'O3&N2+N3*M20K3/J20J50J5,K5,K5-K7.L8.K;.K;-J:-J:-J:-J:-I<-I<-L>-L>-L<-L<-L<.M=-N@.OA.OA-N@&G9:, "  ..)jjeŽѷȳɰƯDZɲʳ˳˲ʳ˲ʱ˱˱̰˰˱̮ʮʭˬʬ˫ʬɭʯʰ˰ʮȱɱɰưƱɱɮɯʮɯʰ˰˱ʰɰɰɰɰɯȯȯȯȭȭȫȫȫȫȫǫǭǭǭǭǬƬƭǬƬǫƫƬǫƫƪƪƮƭŮƮƭŭŭŭŪĩéééĪŪŪũĪŪũĩ訧¦rYisTfp\nx^ov^ov^ov^ov\ov\ov[nu\ov^ov]nu_lx_lx^kw^kw\kw\kwXmvXmvXlwSgr@R]$6A$4>,-V<-V<.U;.U;0T=/S<.S8-R7.S8.S8,R;,R;+Q:*P9*R6*R6*S4)R3%R5%R5%Q6$P5&P4%O3'P0'P0&P4&P4'O9%M7*M8)L7.L8-K70K:0K:/L-L>)L>)L>)L>)L>)L>*M?-O>-O>,P?-Q@+QB,RC-RE'L?:12)%"4B7TXLgk_ֿж̳ɱɯDZɱɳ˳˱˱˱̱̰˰˰˰˰Ͱ̯̯̯̮ͯˮ˭ʭʮˮ˰ȰȯǯǯǯDZDZǯɯɭɭɭɭɱʱʰɰɰɰɰɰɯʯʬɬɬɫȫȫȫǫǭǭǭǭǭǭǭǭǭȬǬǬǬǬǬƭǭǬƯǮƮǮǬǫƪƩũũŨĩũũŪĪĨŧħħħ榥¦¦s[lsYjq_pw^ov^ovZovZovZoxZoxZoxZox^nx^nx`my`my_lx^kwYkvZlwWluWluWluI^g2AM(7C/H)=B&:?-;=/=?3>B2=A-)5='3;-38,27+16+16+16,27*59-80T=0T=0T=0T=0T=.T>.T>,R;,R;,S9,S9)S7'Q5(Q7(Q7'O9'O9'P8'P8(P4(P4)O8)O8)N;(M:)N;)N;-N9-N9/L0OA0OA-N@,M?(N?)O@*PA*PA*PA+QB+QB,RC,RC-SD)QH$LC"E=+# SVNճα̬ˬ˱˱˰ʰʲͲ̰̮ͯͯˮʮʯ̯̱̱̱̱̱̱̯̯̯̯̯̮ˮʮʮʯ˰ʰʰʰʰʯɭɭɮˮ˰˯ʱʱʰɰɰɱʯʯʯʮɮɮɬɫȫȫȭȭȭȭȫǫǫǫǫǫǫȪǪǨŬǬǭǭǭǭǭȬǬǬǪƩŪƩũũũũŨĨĨħèŧħħħĦææ訦¦¥~o[mw\ov_ry^rw]qvXoxXoxXoxXoxZoxZox^my^my`my_lx\ny[mxVlwUkvUkvWmxVhrCU_.9D0;F5;G4:F5>A6?B=HFALJAMOAMOBPRFTVFU[GV\HXbHXbJYeKZfI[fJ\gH]fH]fCWb=Q\4LY0HU*EO%@J*C?%%% ""$ JJTŹݳӣÅlJqy(OW%) %#9*/S55Y;3]A3]A5\B3Z@0YA0YA0YA/X@1X>0W=2W=1V<3U<3U<3T?3T?3T?3T?2S>2S>1S:0R9.T6-S5)R8)R8+Q;*P:)P6)P6+P5+P5+O8+O8+N9+N9+N9+N9,O:,O:.M=.M=/N>0O?1P@0O?/PB/PB-PB-PB-PB.QC/SB/SB/SB(L;8( +  4@5q}rռегί̮˰ʰʱ˱˳˳˴̴̲Ͳͯˮʮʯ˯˯˳̴̳̳Ͳͱ̱̱̰˰˱̱̯ˮʮʮʮȮȯɮȰ˰˰˯ʰ˱̰˯ʯɰʱɱɱɱɱʰɱʱʯʮɭʬɫȫȭǭǭǭǭǭǭǭǭǭǬƬƬƬƬĭūŪīǫǭȬǭǬƮƮƬƬƬĬĪĪĩè¨ĨĨŧħħĩè©è¨¨¨¨¨¨©©¦s\lvZmt^qx[qv[qv[pwZovZoxZox^nx^nx`my`my`my`my[mw[mw[mw[mw]mw^nxLX`;GO/5A5;G36D25C/4=.3<(.3,273<8=FBCPNERPFT^HV`JXbLZdJZdK[eKZfL[gL\fK[eHY`BSZ?NZ:IU4FQ1CN/>D-2=A5>B5>B3>B2=A0:A.8?-8<*59,59+48+47,58+79-9;-;=2@B1CF9KN;PYK`iSgrXlwWmxXnyYpy[r{[u{\v|^x~_y`zb|a~bd}e~hilmmnopppoooqrsvwxz:EI@KOEQYZfn\nxgymrx~Ƭȯɲ̶иҼԾۿۿ۾ٿ0T=/S<-U9,T8*S;*S;+Q;+Q;*P:)O9+O8,P9*P:*P:(O<'N;(P:(P:*P:+Q;/O=/O=2O?3P@3OB3OB2QC2QC/OC+K?&G9#D6"A9>67/ +# %+4*4=3BD?kmhҹѵͲͲͰ̯̯̯̰ͯͲͳβͲͱΰͯˮʰȱɱɱɳ̳̲Ͳͱ̱̱̱̱̱̱̱̰˰˰ʰʰʰʰʰʰ˰˱̱̱̰˰˰˯ʰ˯ʯʱʱʱʰɯʯʯʯʬɬɬɬɮɭȮɭȭǭǫǫǫǫǫǫǫǪƫūūŪīǪƬǭȭǭǬƬƬƬƬƬƪƪƩŨĨŨŨĨħççæ©è©è©ĩĨ¨ª©¨è秧§¥¥¥¥¥¤~r\mtTip\qx[pw[pw[pw[pwZoxZox^nx^nx`my_lx^my^my]mw]mw\mt]nu`nv\jrCJS07@9;E57A63=-*4-#&* #($=52LSIPWMIVTLYWMZ`MZ`NZbO[cM[cM[cK\cIZaEWaBT^:P]7MZ2HU/ER/AL*B1>B/""!% JLQɹڿپؾؾؾدРoT}(Q[ *2 #0!;'"J4*R<.UB1XE0VE/UD/VC/VC1VC1VC.UB.UB-TA-TA/U?/U?.U;-T:*S9+T:.Q<.QD$392:A,4;"%3'   &,+@JDMWQIVTMZXOY`PZaNZbNZbM[cM[cI]bH\aG\eDYb@T_;OZ8LW5IT1CM+=G0:A2B3=D1;B/:>-8<+8<*7;*98+:9*;<->?.AB3FG5MMAYYKafWmrZpuZpuYpy[r{[t}\u~[w]yazb{e}f~eefghhhhijklppqrstvvwxxy7CK=IQAQ[VfpZoxezot}ũȪȮ̱ϵӷѺԽֿ:?:  # $ IJRɻվڿٿٿٿ޽ضѥǑybVtuCab,JK67#&(!( +#:()G5!J0'P6-U?/WA/WA.V@/U>/U>/U>-S<-S<,R;/R=/R=/R=.Q<.Q<.Q<.Q<.Q<,R<,R<+Q;+Q;,O:+N9)G5<*-!(% &!$" 6?;S^Ujulx|ÿֿռҷӴддгвϱααααΰͲͲͳγγγαͱ̮̮̰̰̲̲̳ͯͮβͲͲͰͰͰͰͱαβͲͳ̲˲˲˰˯ʱ̱̰˱̰̯̮ͯ˯̮˰˰˰˯ʯʯʰ˰˰˰˰˯ʯʮɯʮɯɮȮȮȮȮȭȭȯȯȯǯǭǭǫǫǫȫȫȫȭǭǭǭǮƯǯǯǬƬƬƬƬƫŪŪūŪĪª¨¨¨ħæ§çççħĩĨé覥p]nuZmt^qx^qx]pw]oy\nx\nx\nx\nx\nxZoxZoxZoxYnwYnwYnwYkuZlvP`jLSOHSWKVZJY_KZ`KYaLZbK\bK\bG]bH^cMekQio@Z`B5>B4?C4?C1>B1>B/<@.;?,:<-;=+<;+<;,=>/@A1EC7KI.;% 3 $  (#HTOnzu׸ҷѵҵҳдѴѴѱаϯίαααΰͱббббαααίήͮͮͯίί̰̰̰̰̱ͮααααΰͲͲͲͱ̰˰˰˰˰˰˱̲ͱ̱̯̮˰ͰͲ˳̲˲˰˰˰ʱˮʮʮ˭ʭʭʮ˭ʭɭɭɭɬȬȬɫȭȭȯȯȭǭǫǫǫǫǫǫǭǭǭŭŭǭǭǭǬƬƭǬƫƫƫƫƩƩƩƨŨŨŧħħççħħħħħħ楦¥{pZlvSho\qx\qx\qxZov[pw]pw\ov\ov\ov\nx[mw^my]lx]mw^nx\lvXhrGU]-;C0=C1>D'7A 0:-61:!75%;9+=:.@='87,=<6CABOMJQTNUXLW[NY]K[^M]`I]bI]bE]cG_eLloSsv@_d9X]9U]A]e@U\.CJ1;H0:G7=B9?D5AC5AC0?E/>D/=E.D.=C,>A-?B-@A0CD4IJ9NOE[`TjoZpuZpuYrv\uy[u{\v|^u~`wbyd{c|e~cdddefdefgikpqstvwuwwxwywx5EH:JM@PZVfp]oygyqv~©Ŭ˯γҵԵӸּؾڿٿꫴ14+ %! LKX²øοؾؾؿپܾӶѮɜoTx|?cg+PX3; "+(#&(+85/JG/TA,Q>/P;/P;3O;&B.)      #%-'=E?QaVl|q¿پԷѷѸҸҸҸҹҸѵжѶѵгвϲϱβϲϱαίίίίααααααΰͱαͱͰ̰̱ͱͰ̰̱ααͱͳͳʹʹʹͳ̱̰˰˰˱̴̱̳̳̳̳̳̳ͳ̳̳̳̳̲ʲʰʱ˱̰˰˰˯ʯʯʯʯʯʭʭʬȬȮȮȮȮȰȯǯǯǯůŭŭŭǭǭǭǭǬƬƭǭǭǭǭǮƮƮǮǬǫƬǫƫƪŬŬŪũĨħçççħħħĩĩĩ訨¦¥n\nxZlw_q|^qx^qx]pw\ov^ov^ov`nv`nv`nx_mw_mw_mw]nu^ov\mtN_f9HN!06/<@0=A/=?-;=/>=6ED9FE;HG@MKIVTL\_DTWB4?C5@D7BF3@D1>B2?E3@F1>B1>B1>D1>D2CD5FG;KNAQTOejYot[qv\rw^uw`wy`u|`u|cxdyd{d{d}e~deffffijmnpqttuuwwuwvvwx|}5FG:KLBSYTek\pufzrx~ĬʯͲѴӸָֻ׼ؾؿٿٿٿٿ螧'*'##" OSRǰ˿ؾؾؾؾؾؾݼ׹ԵЪũ~nekg%AV!6$C:!@7-C4.D5#3(*:/XedCPO9IFD1>D4@B9EG8HE;KHG5B5@D7BF5BH4AG3BH4CI1AD0@C/>D1@F5EH9ILDU[L]cTktXoxZsu\uw]vz^w{av}cxezf{e}f~fgfffgiillmmqqrssttutuvwy{||4DG:JMCUXTfi[prf{}pv~èƫɯͰεӸԸԼֽ׾ھھؿپ׿ؿؾ׿ڼ׼׾鋖,%&*#$# UUUˮ̷׽׾ؾؼֽ׾ؾؽ׿׿׿׾־ڻGV\%""2/02-&(#555qozվּԶҶҶҶҺкклѺҹѹѹѸииижѵегααααααααααα˱˱˰ʳͳͳγααααίͯͯίήͮͱααΰͲͲͲͲͱ̱̱˱˱˱˳˳˳˴̲ͲͲͲͱ̲ͱ̱̱̱̰˰˰˱̱˰ʰʰʰʯɯʰ˭ʭʫʫʫʫʭʭʯʭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭǬƯȯȮǯȬƬƬƫūūūŪĩŨĨĨħççĨŧħĨŧħħħĦçħĦææå¦å¥¦ã£££¥~j|[mx`o{ap|ary_pwaoyaoy_pw_pw\ov\ov\ov\ovYnuXmtYlsZmtSak+9C(0=2:G4:G5;H5=D7?F6CB9FE8HE;KHALJCNLENQGPSFSRHUTEVUFWVFWXGXYKX\N[_M\bO^dQ`fUdj\ovcv}I_j?U`:NY/CN0?E3BH5BF2?C3>B3>B5@D8CG7DH7DH5EH4DG1CF0BE0BE2DG3GL;OTD]fMfoRpxSqyXuyYvz^v|`x~cxf{d}e~gghhhhllllnoppppnoprsswwxz{}~~2CI7HN>PZQcmZmtdw~pv}ŭȬˮͱдӵӸּֽ׾ھڼڼڼؼؼ׼׽ؼ׼׼׿|  #&""!XXXϬ̸׾ؾؾ׾ػٻٻ׻ؿ׿ؿ׿پؿ׿׿׿ؿ׾ֻԻԹһԻ׼ؾRXW  AIMBKOENRGPSKTWMWWMWWKXWKXWIX^L[aL]dN_fPdiSglVkrbw~Kal?U`=OZ3EP5AI5AI5AC5AC5>A5>A7@C9BE;DH;DH9EG9EG7FE5DC2EF0CD7NPCZ\MdmUluWr|Xs}YvzZw{`x~bzc{e}ijkkmlnnnoooopqqopnnopstvwz{}~7BF>IMAOWUckYkudvn~t}ĭǯɳ͵͹ѹкѾؾؾؾؾؾ׾׽ؼ׻ּs~  $#&%#[[[էǷϿؿ׿ּػ׺ֻ׾ؽ׿ؽ׽׽׽׿׿׾־־ؾؾؾؿ׿׾־ֻּպԹӹոԸշԸպKKK @=F⫲ȈֿԯğǶ̵ѵѳѳѳѲеѵѷѷѸикҹѷҷҷҷҸѸѸизϷϵдϲϲϱααααͱͱͱͱͱͱͱͳͳͳͳͳͳͱͱͱ˱˱ΰͲͱ̲ͲͲͲͲͲͲͲͱ̲Ͳ̲̱̱̲ͲͲͳγ˲ʴ̴̴ʹͱ̱̲Ͳ̮ͯˮʮʯɯɱɰȰ˰ˮˮˮʮʮʮʭɭɭʭʭʭʬɬɮȮȮȯɯɮȮȮȮɭȭȭȭȭȫȫȫǫǫȫȫȫȫȫȪĪĩêīëìƫŭŬĬĬĬŬŪĪĨĨĦĥåĥĥĥĦæ奧¦¥£¦¦p]ntaowcqybpxaow`nx`nx`nx`nx^nx^nx\nx[mw[mw]oy[iqJX`;EM3=E2>F1=E1>B1>B3?A2>@4=;097541541740B?;GG@LLEOPMRSPOUTQWVKXVLYWHYZK\]N^aRbeRdgVhk[otbv{LbmBXc:R_0HU3BN0?K6AE5@D3?A3?A5>A8AD=DG=DG9EG:FH5EH4DG5EH6FI=SXLbgSjsXoxZs}\uYwZx_{_{e}giijkkllmopoppqrrppppqrvuwxyz{}~7AI=GOAOYUcmYkudvmry~ìȯ˯˱ϷնҶҼ־׼׼׼׼kxv  $$''!cbfߧôʼؾھھھھؽ׾׾׾ؾػٻٺغؽֽֽֽֽֿֿ׽׽ٽٽټغغغغؼؼؾ־־սԽսսռԻӻӽֻԻԻԻԺ;:7# >>H㦯dž̹έ¡Ƶ˶ζγѳѳѳѴҳѵѶҷϷϵѵѵҵҵҵҷҷҶѶѷзееедϲϲϲϱβββββαͳ˴̳ͳͳͳͱαααααγγδʹ͵εδʹʹ͵γγΰͰͰͰͰͰͰͱγγε˵˴ʹʹʹͲͲͰͰͯ˯ˮʮʯ˯˱˱˱˱˱˱˰ʰʰʰʮ˭ʭʮˮˮ˭ɭɭǭǮʮʭɬȬɬɮɭȮɮɫȫȫǫǫǫǫȫȫȫȩȨǨƨƩŪƪƪƫūūƫƬŬŭƭƨŨŨĨĦĦĦťĥĦťå榦¦¦æææ奧¨©p^nxbpxcqycqyaow`nx`nx^nx^nx\nx\nxZovYnu[mwWisTbl;IS)8>2AG1AD0@C/@A0AB5??1;;666...'##'%%@@9HHAOKKTPPTRRWUUMXVOZXJZ]L\_M_bQcfTfiXjm[ot`tyLbmCYd;T^4MW3EP0BM3@F3@F5AC3?A5>A7@C>H㥭DžȺүǥijɸйѵҵҴӳҵҴѷѷѸзϵѵѵҵҷҷҹҸѸѸѷззиѷзгγδϳβϲϲϲϴδδ̴̵˶̵͵ͳͳͱͱͱͱͱͱͲ̳ͳͲ̵̲̲͵ʹ̵Ͳ̲̱̲ͱ̲ͲͲͳγβ̲̳γγβͲͲͱ̱̱˰ʰȱɱɱɰȰȯ˯˯ˮʮʮʯˮʫɪȫʫʬˬ˭ǭǭǮȮȮȮʭɬȬȮȮȯʮɬɫȫǫǫǫǫǫǭǭǫǪƪƩŪƪƪƪƬƬƬƫŪūƪūƫƫƫūũŨĨĨĨĨĨŧĦæèè榧樨¨¨¨§pap|^nxaq{`qx`qx_pw^ov^ov^ov\ov\ov\ov[nu^ovWhoLV^1;C-7?5?G0?E0?E1@?1@?5==-55&&&))"..',/'25-:>=<@?CCCLLLPQNTURLYXN[ZI[^K]`N`cRdgShjVkmXns]sxNclG\eAV]:OV8IP3DK3@F3@F5BA4A@5??5??;BE=DG:EI9DH5DJ8GM9JPJ[aMekWou\s|^u~`x~bzb{}d}fgklllkllloooorqqrrrrstttuwxxyy{}~~7BF>IMHPWZbi]kuhvov{ïdz˹λнҾӿؿ׽ֻֽ׻[id!%!$ssȏɽҽֿ׿׾ؾؾڽٽ׽׿׿׽׽׼ؼؼּּռռռս׼ֽ׾ؼֻռֺֺֺֺֻּջտտտվԼԼԼֻջջջպԼԻӼԿ賹$ EEVψ~ӱʦIJʸкҸҷѵҴѵҵҵҶӷѷѵѵѵҵҷҷҹҹҸѸѶѵееедϴϵдϳδϴϳδ϶ζεͶζε͵Ͷγͳͱαααααααβͱ̴ʹͳγγͳͰ̰̰̰̰ͱγγγγγγγγβͳβͲͱ̰˲ͱ̱˱˱˱˯˯˭˭˭̭̮ʯ˯ˮʫɫɫʫʬ˫ʭʭʭʭʭɮʭɭɬɭʬɬɯʯʮɭȬȬȬȫǪƫǫǫǩȩȧƨǨƨƪƩũƩƪǩƫƫƫƬǫƫƩƩƩƩƨĨĨĨħççħħħħĦæçĨèèèèè秧§§§§~n\nyZlv^pz_q{^pz]oy]oy\nx\nxZpuZpuZovXmtapvVek:DL-7?3B2?C3AC2@B-;=,.&&4;7=D@3DE3DE2EF3FG3@>>KIFPJKUOMYTP\WL]\M^]QadTdgVgmXioWmr]sxMbkF[dAU`;OZ7HV2CQ2?K1>J6AE4?C6@@5??;A@>DC=EELN@RUQcfPltWs{Xv~Zx_{`|a}cghijlllnnnmmoprqqrrrssuuuuwxxy{||~2@H8FNBPZTbl\kwetkqv{İȳ˸λѼҿվֿڿ׿ؽ׽׼ּ¹U`W%$!!*ꞧžֿ׿׽׽׽׽׼ֽ׽׽׽ٽټؼؽּռռպպպֻ׺ֺֹպֺֹոԹջ׻׽׽׿׿׼ֺּԺԺԺԹӹӻպԸҷѹо秴  !  _]nҍбʨÚ®ȴηѷѷѷѷѷѷѷѷѵҴѵҵҴѴѵҴѶӶӶѶѵеедϲϲϲϲϴϴϴϴϳδϴδζζζζε͵͵Ͷε͵ͳγααααΰͰͰͰͳγγγβͲͲͲͲͲͲͳγβͲͳΰͱΰͱΰͰͱ̱̱̱̱˱˱˱˱˱˯̯̯̯̮ʯˮʮʮʮʬˬˬ˫ʯʮɯʯʭʭʭɭɭɭɯɯɮȮȮȮȭǭǮɭȭȭȭȭȭȭȫǪƫǫǪƫǪƪƪƪƪƪƩƩƪǩƩƩƫƫƪŪŨŨŨŨŨũƨŨŨéĪêêêêé¨è秥¥¥¥¥¥¥p}]jv`nxcq{ary`qx^qx]pw[pwZovZovZovYnuVkrTciETZ.6=3;B5;G4:F5G8BB3==!LRQTV`PR\=IQ:FN7HG7HG8JG8JG?NMCRQJVXLXZN[_P]aRagUdjUinWkpZpu\rwK`iF[dEU_AQ[?MW:HR4CI1@F7BF7BF8@@5==9>?=BC:DD:DD8IJCTUE^bVosYu}Zv~\y~_|`}ceeijnooprrrrrrrrrrrrrsstttuuvxvwxz{||~6@G;ELBNVUai[lsdu|jqxzĭDZ˵̸ϺѺѸѽֽ׽׽׽׽־׽׽׺ع顩CK=# !!%+0㡨ȽӾվվվվ־־־ֽٽټؼؼֺֹּּּչ׹׹׺غغغغع׹׺ֻ׻׻׻ػػ׻׹׹׹׸ֺԺԹչջպԹӺԻ栫   !  yuﯭˎ}έȩƝǰʴεͶθизҸӵҶӳҲѳҳҲѲѳҴӴѴѴѳвϲϴϴϲϳвϲϲϲϴϴϴϴϴϴϴϴϴϴϳγγδϴϴϲϱΰѯЯЯаϱбαγγγγβͲͲͳβͲͳβͲͳααααααΰͱαΰͰͰͱ̲Ͳ̱˱˱˱̱̱̱̯˯˯ˮʮʮʮ˯̯̮ˮˮˮˮˬˬˬ˫ʫʬˮ˭ʭʭʮȮȮȮȮɭȮɮɫǬȫǫǫǫǫǫǫȫȨƩǨƨƨƧŨǨǩȨǧƧƩƩƩƨŨŨŨŨŨŨŨŧĩĨèç¨èêê秥¥¥¥¥¥¥¥¥¥¤¤q_mwbpzcq{`qw`qw^rw]qv\ov\ovZoxZoxXmvXmvKXd;HT3;H3;H3;H19F5HH3>FMP[:LW7FR1@L3?G:FNAJMCLO8GF7FE5HI9LMBWXNcdVnt\tz^v|bzd}fehiklmppqqonnnpppppqqpqrrsuvvvxxxy{|}~3AK9GQBPZTbl\kqgv|pv{ƲɱʹгѷնԸּؼػ׻׾ؾؽ׽׽׽׼ֻmli6'-Nblݑźҽ׽׾ؿټؼؾؽ׽սսվֺֹּּּּּּոԹպغػ׻׻׼ؾؽ׽׽׻׺ֺֺֺֺֺֺֺԺԻӻӻӻӹչչշӾ↏   ᬲǭŭã°ŵʸθδѵҴѴѷҸӸҸҷѷѴѳдѳдѴѴдеегδ϶ѵгггггвϳвϵдϴϴϲϲϲϲϲϳгггггвϲϱααγγδϳεεγγγγγγγγγγγγγγγγγγααααγβͳβͲͱ̲Ͳͱ̲Ͳͱ̰Ͱ̭ͮ˭̭̭̭̬ˬˮˮ˭ʮˮʭɭɭɯʯʱʰɰɰɮƮƮƮƮɭȭȭȪɩȩȩȫȫȫȫȫǫǫǫǫǫǫȫȫǪƪƪƪƪƩƨŪŪŪĪĪĩèĨĦĥççééꪨèæææ¥j~Wkv\ny_q|_ry^qx_pv`qw]qv\puZov[pw[lsO`g7?F,4;7=D5;B2;F3B4=A4=A7@D;FDALJUXP[^VhbZƛ[Z^0/3MRUMRUFKLINOLRQKQPJOPJOPKSSNVVO\[S`_TefZklZkq^ou]u{bzNdoG]hFZeBVaAV_@U^UQF]YRllYss\u_x`}befiklmppppppppqqssrqopopttuuvwwxxxxxyz|||~3?G9EM?MUQ_gYisdt~i~px|ðdzʳϵѶҷӸԺֽ׽׾ؾؾֿ׼ռպչԻ$ %) #  ֮̒͹վڹ׹׺غغֺֺֹչչչ׹׺غعչոԸԹ׹׻׻׽׽׽վ־ּԼԼԼֹּּּּּּּչչոԹոԸԸԷӷgsh  9XWۙǯǤĴʷѹӳҳҵҶӷҸӺӺӸӷҴѴѲѲѳҳҲѲѴѴѴѴѲѲѲѲѲѲѱббаϱбббббббгггггггвϲѲѱгҴѴѳгдѳбαααγγγγεεεεεεγγααίίίίαΰͰͰͲͲͳγααΰͰͰͰͰͰ̯̭ͯέέ̭̭̬ˬˬ˭ʭʮˮ˯ʰ˯ʯʯʯʭʭʭʭʬɬɬɬɬɬɪɩȩȩȩȩȩȩȫȫȫȫȫȫȫȫȫȫȨǨǨǨǧƧƩƩƩƨŪūƫƫƪª©êĪũĨéĩé榣£££££¥¥¥¥¥~gzUhv`r}`r}_ry^qx_oy_oy]oy\nx]mwXhrKW_2>F6?C7@D5=D4B4@B7CE9FE>KJEQLJVQKSKNVNJSQV_]OT]7HHFORYbe\jrft|gmv{ŰǴ˷ззкӸԺֺֺֺջֺӼռ׺չջ׻᫻  %&&'٦ƾӻԻԷշշշչ׸ֺԻջԻԻһҺӺӹոԹոԽստտս׼ֺֺֻ׺ֽ׼־ԾԾԽӹոԸԸԹչչӸҷѷ흞"$'!  nλԡȯť­DZ˷ѶѷҸӸӶӶӶӶӵҵҴѵҳҳҲѲѱвѱвѲѱгҳҳҳҳҳҲѱбббвѱбгггггггдѲввбϱϱϳгеедϴϳγγγγγααή˰ͲϲϱβϲϱβϱγγγγγγγγγγαααΰͰͰͰͰ̰ͯͰͰͲͲͲͲͲͲ̭̬ͮͮͭˬ˯̯̮ʮʰʰʮʮʬʫɬ˫ʭʭʯʮɮɮɫȫȩȩȪȪȪȩǫȫȭȭȫȫȩȩȩǩǩǨƨƨƨǨǪǩƩƩƫƫƫŪĨ©è¨¨ŨŨŨŧççæ¦æ奥¥§§¥n|^lvcp|dq}arx`qw^rw^rw]qv[ot]ksES[;EM7AI7BF6AE3@D4AE5BF7DH:HJ=KMEQLGSNJVP?KE1>GK?HL@IM@IM>IM=HL9IL:JM:MN=PQARSGXYL]^RcdVfiZjmYls\ovbu|fyXipRcjN_eK\bD\bC[a@X^=U[9NW5JS5KP7MRCY^Rhm\uy_x|`|}dejlmnoqrvwyyyxtttutttsstvvuvvwyyxxvwvwwx}~1AD7GJ;JPRagRku\u`~fuzªƭDZ˴̸икҹӻջպԼԺҹѺҼҼҼҼѽto%%(#& GCYž몴ť׺Իջռֻ׺ֻ׻׻һһһҼֻո׸׹ظ׹ջ׻׺ֺֺֺֺֺֹվֽսսռ׻ֺԺԷѸҸҸҷѸҸԺMII)%# !  ůǫæĶʸ̹ѺҶӶӶӶӸӸӺӹҷѷѵѶҳҳҳҳҴѵҴѵҵҵҵҵҵҵҴѴѴѴѴѴѴѴѴѴѴѴѴӴӴӵԵҴѶѶѶѵггггггвϳгггеҿڳΒĹԵдζееедϴϳδϳγγγγαααααααΰͲͲͱΰͰͱΰͰͰͱΰͰͰͰͰ̯̯̯̯̯̯̮ͯ˯̯̮ˮˮ˰˰˯̮ˮ˭ʭ̬ˬɫȬɬɬȫǫȬɫȫȫȫȫȫȫȫȩȩȩȨǨǩȩȩȫȪǪǪǪǩƩƩƫƫƫƫƫƪŧĨŧħħħħħĦæ奧§§¨ç¤o}_mu_nzap|]r{\qz\rwZpu_pvUflJW]1>D6@G7AH7>G7>G8@G;CJ>GJAJMBKNDMPGOOGOOHNMGMLGLO@EHIM;KN;KN8MN9NO=PQ>QRBSTFWXM\[Ra`Vdf[ik\kq`ouat{dw~TirNclJ_fH]dF[dDYbAU`;OZ8JU7IT6IPCV]K`gYnu`u|ezgjhlkmnntuwxwwwvwwuuutttvvvvvvvwwwxxvwxyzz~~0@C7GJ=KSQ_gRhs^tgny¯ųɳ˶ηιйκϻӺҵӱϴҵӷзййFR?'!-"( #msۣæػռֻջպԻպԺԽսսսջպԸַַַָָ׸׷ֹպֺԹӼԼԾԾԼҽӻպԹӸҸѷзѷѷѸҺ.60 !#!  ƫæ¸ͽӻѵѵѳҴӶӶӸӷҷѷѷѷѵҵҴӳҳҲѴѴѴѴѴѴѶѶѸѸѷзежѶѶѴѴѴѴѵҵҵҴѷҶѶѶѶѶѴѳггвϲϲϲϵежѹԹԤθӴϷзед϶϶ϵζϵεδϳγγγδϳͳͳͳͱααΰͱΰͰͰͰͰͱααΰͰͰͰ̰̰̰̰̯˯̯̯̯̯˰̯˯˯˯ˬ˭̬˫ʬ˫ʫʪɪȫɫɪȪȫɫʩȭȭȭȭȩȩȫʩȨǨǧƩȩȩȩȩȨǨǨǧƨŨũƩƩƩƩƩƨŨŧħħħħħĦæææææèèêé©©©~cxUjq^r}]q|]r{\qz]qv\pu^msM\b;JP3BH3BH2AG0?E0?E9AH=ELBILDKNELOFMPEMMEMMCMMBLL@KO?JN;LM;LM;MJ;MJMSP_eVjobv{ezi~jnjkmooottxxzzwwuustttvuuuwwuuuuvuvvwxyyz{||*?F0EL6MVI`iNjrZv~djw~Ʊ˱˴δδеѴӴӲӱҳӲҴддҴ뚛"#  "%"+( /BIפ«ļ׽ԺԺԻ׻׻ջջԻԻԻԺӺӹոԸֵֶֶָյշշշշջ׹ջպԻջչչչӸҺҹѹѹѻѼһ,2*! #   ߩŬ¨ǽӻѸҸҴӴӴӴӶӵҸҷѸҸҸӸӸӸӷҶѴѴѳҲѴѴѸѸѸѸѵеежѶѶѶѶѴѴѳҳҴѴѹҸѸѸѶѶѳггвϲϳгггϴзҺլɘδвδϴ϶Ϸж϶϶϶ϴδδγͳγεεε͵͵͵ͳͳͱͱͰϯί̯ͯͮͯίήͮͰͰͰ̰̰̰̰̯˯˯˯̯̮ʯ˯˯˯̮˯̯̯̮˭ʮ˭ʭʭʭʬȬȪȫɪɩȭȭȭȭȪɪɪɩȩȨǨǩȩȩȩȩȫȫȪǩƩƩƫƫƩƩƨũƨŨŪũĪũĩĩħħħ榦¦¥©§dyXmv[q|[q|\qx\qxbqw]lrTdg9IL,D3BH9EGMSRagTir_t}diuzïưDz˳̳ʹγеҶѶѴдеѴжиwol 1, %.%  Q^b嬺ʡĩؿԼּּԼԽսվֽսռԺԺԸԸԸַָָնԶԷշշշշֶַַննշַֹӹӸҸҹѺҹӹӻ഼+.&!!! ')5񧴸Ʃò̴θӸӴӴӴӴӴӴӴӴӷҸӷҷҺӹҷҶѱвѳԲӴѳиѸѸидѴѴѴѴӵԵҴѴѴѵҵҶжииииддбббббаϴεϵϵ϶ѹԮˣ˱вϲϴδδδδϵедϴγʹγʹϳγγγͳͳͳͳγαͱͯίίͯͯͯͯήͮͮͰͰͲͲͰͱή̭̭̭̯̯̯̮ͮͭˮ˯̮˯̮˭ʭʭʮ˭ʬɭʭɬȬƭǬɬɫȫȬɬɪɪɪɩȩȩȨǩȫǫǫȫȩȩȩȨǨƧŨƧũũũƨŨŨŪũĪũĪũĥĥĥĥĤäææ秩©§fxXjuZqz[r{\qx[pw^nxXhrO\b>KQ0=A5BF2BE0@C2CD5FGE6E2CJ6JUJ^iRhs^th}oz}Īƫǭɮʮ̯ͭέ̫ɮ̯̳ͮ˻־GND %% --(%% vۻΨƺϽһѼҸֹ׹պֺֺֻջպԺԼԼԼֺֺֺֹּչչշշշնԵӷշշչӹӺԺԻӼԼջԼջԻpzm!& %!%!dfp梲ȽѾҺҺҶӶӶյԵԵԶննӶӸӸӸҸҶҶҴӳҳҳҴѴѵҴѳҳҲӳԳҳҲѳҲѲѴѴѸѸѹҸѷҷҴѳгггдѵеееггггдѶӴѳбббаϳггггϲγϲβϲϴϴϳγγͳͱͱͱαίίίίί̯ͯͯͯͯͯͯͮίίίίίίή̭̯̯̰̯̯̮ͮͮͮͮͭͯʮʯɯɯɯɯʯʯɮȭǮȮȭǮɭȮɮɬɬɬɬɭȭȭǭǫǫǩǩǪƫǫǫǬƬƬƫŪĪīūŪŪŪŪŪŪūƪũĩĦææ奥§§§cuZlv[pw[pw[qv\rwWhnK\b4CI5DJ5CM3AK2BE4DG:JG=MJANLBOMCOQBNP=JN8EI'&!#'& ##$ !!!)")EBFROSTWXMPQENQFORGPTGPTIQXMU\RX_U[b[dhclpkx~tZiuQ`lH[iDWe@N^7EU6EQ9HTD\bRjp\v|d~nruyyyz{{{{{|{{{{{yyyyzzzz{{yyyyyxxyyz{z{|{{{|}~3>B9DH=LRO^dUhobu|osy}¬éĪŪƫǭɮʰ̬ȪƬȭɬȮʷҤ;C5')$&(#"% ǣŷʺϽһպԻԽֻֽֽպԺԺԼԻӼԼԻ׺ֺֹչչչչշնԶԶԷӷӸҷѻѻѼԻӻԻԹԹԻ?D@$$("& !29ߢŵ˻ѻѹϸӸӵԶմմմӵԴӴӶӶӸҸҸҸҴҴҴӳҲѳҳҳҳҴӲӲӳҳҳҳҲѲѴѴѹҸѸѸѷҶѲѲѴӳҴѳггггббббвѲѲѲѱбббббгдѳггггвϴϴϳγααίίίΰϯίίͯͯͯͯͯͯͯͯίίίίίίή̭̯̰ͮͮͮͮͮͮͭͰͰ̯̮ͯ˭ʭɮʮ˭ʮˮ˭ʬɬɬɬɫȬɬɬɬɬɬɬɬɫȬɭǭǫǫǫǫǫȫȫǫǪǪǩƪǩũũũŨĨĨŨŧĨŧħħĦæææ奥§§§¦`u~Ynw[r{Ypy[pw[pwQakCS]6DL6DL5DJ4CI3FG5HI9LMONARQ@QP@QPBQPAPOBON@ML?LK?LK?LJ>KI7HI=NO;LM;LM@LN;GIAKKDNNHORGNQFLQFLQENRENREMTGOVHPWMU\S\`\einwz|^hpV`hHUa?LX7EM:HP;PRJ_aYsyb|djrtxz{z||||}}||xxxxxyyyyyyyzzzzzyyzyz{{|}~~~3=D9CJ@JRS]eYgqft~g~ox{¨©éƪǩƪǩƩƩƩƭÿվZd^!  ((#''" CEQ꫻ijȶ˺ϻлҼӼԼԺֺֺֺֺֺֺּּּּ׺׷ֶַַַַոԹպҺҺҺҹӹӹӹӻӻӻӼ"%25-$" JTTǤıǵ͸йҺӸӸӶӶӶӶӸӸӸӹԹԹԸӸӶӶӶӶӵҶӶӶӷҷҶѷҷҷҳҳҲѲѳҴӹҸѸѸѶӵҳҲѲѲѲѲѴѳдѴѴѳгдѴѴѴѳгггггггггггвϳгвϲϲϲϲϱβϱΰϯΰϯαͱͱͱͱαίίίίίίαααΰ̭̯̯̯̯̯̰̯̯̮ͮͮͮͮͭͯˮˮˮˮˬˬ˫ʪɪɪɫȬɬɬɮɮɮɮɮɮɭȭȫȫȫǫǫǫǭȭȭȭȭȬǪǪǩƩƩƩƫƫƨĨĦĥåĥĤä楥¥¥§§¥¤|ZrxPhnVpvVpvShoLah4CI5DJ9GO7EM7GJ8HK;KN>NQ@QRARSCQSCQSDPRDPRENQDMPCLOCLODMPBKN;LM=NO8MN6KLB7DHAIPU]dYgoes{i}q{~¦¥æħĦææîٲ7>:/5$*-%%(  *ks婸ȴ˸͹ιйкԺԺԹӺԺԻӼԼֻּջչֶַֹննննոԷӸԸԺԹӹӹӻԻԻӻӻѿ{| 785230#$!  T_]گ¯ų˶ζѶѷҸӸӷҹҹҺӺӻԻԹԸӷԶӶӵҳҳҴӳҶҵѹҹҸѹҶѷҳҳҳҳҶӶӹҸѹҸѷҷҵҴѵҴѲѲѲѲѲѲѲѳҲѲѲѲѳггггдѳгвϳееггвѱббаϰϰϰϰϯίΰϰϯββδγͳγίίίίίίααΰ̰ͯͰ̭̭̭̮̭̭̮ͮͮͮͮͭͭˮˮ˭ʬˬˬ˫ʪɪɪɪɬɬɬɬɮɮɮɯʮɮɮɯʬɫȫȫȫȫȭǭǭǭǭȭȪǪǩƩƫƫƫƫƩƨŦŦťĥĤ㣣££¥¥¦|ZmtQdkXoxUluPcjDW^4AG;HNKQ@MSBOUCPTCPTEQSEQSEQSCOQENQENQENRDMQCLPBKOBKOBKOBKOBKOAJMBKNBKNCLOCKRCKRCKRCKRCLPCLPCLPDMQGMRIOTSVW[^_hmpz^hpKU];KN;KN;NODWXPik\uwdimrwxyz|||||{}}|}|}||{|||zzzzzzzz{{{{{{{||||}~~,=C1BHHO;EL>EN?FOBJQEMTDNUEOVEPTEPTEQSEQSEQSDPRENQENQENRDMQCLPBKOBKOBKOCLOBKNBKNAJMBKNBKNBJQCKRCJSCJSCLPCLPCLPBKOBKOENRHPWMU\_hkox{\eiAJN2BE9IL;QVMch[t~e~orvy|~~~~~~~~~||{{||}||{|}z{{{zzzz{{||{zxx|}~~~}~0=A3@D:HRN\fXeqcp|l{sz÷ʁ ../99:'(0 !) ,27ԷΟŴʸμҽսչӹӹӹӹӹӺԻջջջջպպննմյִյֶնյԵԵӵӹӹӻӻӻӻӻW_W1:8&/-'' uȩ­ŰʳʹϵиӷҷҸӺӺӺӺӸӸӷӶҶҵѸҸҶӶӵҴѶзѷѷѵҵҶҵѵҵҷҷҹҹҹҹҷҸӷҷҷҷҶѶѶѶѲѳҳҳҳҲѴѵҵҴѳггдѴѴѴѴѳдѵееегггϳϳϳϳвϰϰϰϰϯΰϲϱβϱαбЯίίίίίαααΰͱ̲ͰͰͰ̮̯̯̯̱̰ͯͮͮͮͯ˰˯ʯʰˮˮˮ˭ʭɮʭǭǭɭɬɬɬɬɮɯʭʬɬɬɫȫȩȪɩȩȫȫȫȫȫȫȪǫȫƫƫƫƨŨŧħĦçģ£££££¤{\qxYnuXmvK`i=OY,>H6DL7EM=FJ@IMAJNBKOCLODMPDMPENQDNNDNNGLMFKLFKNGLODJODJOCINCINEINEINEJMEJMEJKEJKEJMDILDILEJMEINEINCINCINBHMBHMBHMCINHLQHLQPS[_bjLSc?FV3BN=LXC`eSpu^{fsv|}~~~~~~~~||||||{z||||zzz{{{zz||||{{yyxy{|||-=@3CF;IQN\dYgodrzm}sz~ůqzv ../778*'1 '4;>ǼӰǠñɵ̹лҾպԺԺԺԻջջջջպԺԺԸոնննյԵԶնյԵԵԵӵӻӻӻӻӻԻԻ嗢>A8(+"9>A(-0$)* %*ŧ¬űʵγεзҸӸӸӸӸӺӻԹԹԹԹԸӸӶӵҶӵҵҵҷҷҷҸӶӶӶӶӵҵҷҷҸӸӸӸӷҸӷҷҷҷҶѶѷҷҵҵҵҵҶѶѶѶѷҶѴѴѳҲѲѲѳдѶѶѶѵжѵеееедϴϴϴϱβϰϰϰϯβϱααίίίίίίαααααΰͲͲͲͲͲͲͲͳβͲͲͲͱ̱̱̱̮ˮˮ˯̯̮˯̮˰ʱˮʭɭʭʭʭʭʭʭʭʭʭʭʬɪɪɪɪɪɪɩȩȪǪǫȪǪǪǩƩƨŨŪũīīīĪç¨å¥¥¤{ZovUjqXhrIYc?LX7DP7DP6CO:EIIM>IMNQΫȜƳ˷ϻмѹӹӸչֹչչոԹոԷӸԸԸԶԶԶյԵԵԵԵԵԵԵӵӹӹӻӻӹԹԻr}{LV:EPGJ=FI=FI=FI>>333"#+ )(;ג~~{|ɲʵ͸мԻӼԶԵӷֶննշӷӸԸԸҷѵӵӵԵԵԵԳԳԳԳԴӵԷԷԷԷԹԹԻ .6.owoINJ$)% ٬Ĭɯ̯αдеѷҸӸӸӸӸӶӶӴӴӵԴӴӳҶӵҵҴѵѵѶӵҵҶӸӸӸӷҸӸӸӸӶӶӶӶӵҵҷҷҷҷҳҳҲѲѲѲѴѵҸѸѸѸѶѶѵҵҴѴѳдѶѶѶѵзззжϵдϰϯΰϰϳвϲϲϴϵдϴϲѲѲѲѲϲϰϯΰϯαααααααααΰͳγγβͲͲͲͳγͨ£ȭ˭˯̯̮˯̱̱̰̯̰ͯͯʯʯʯʯʯʮ˭ʫʪɪɪɪɩȬɫȫȫȫȫȨǨǨǧƧƦŧĦæŦŦťĥ¥¦~}}}~~~zYisEU_>LT1?G:HP8FN8HK9IL9IL8HK7FL8GM8HK8HK9IL9IL9IL:JM5JL5JL3HO4IP3HO3HO5JL5JL9JK:KL;LM;LM?3DEKQI5;3%%% {xɹǗxxvvzxxxyyy~ìƯɴ̸лѻѹѺҷӷӵӵӵԵԷԸշӷӷӷӷӷӹѹѹӹӴӴӴӴӵԴӴҴҸҹӿ =;;}{{NJJ*&&߱zŭǰʱαδѵҶӶӶӷԶӶӶӶӶӶӶյԵԵԵԵԶӶӶӶӸӸӸӸӸӹԶӶӶӷԷԶӶӵҸӸӷҸӸӸӹҸѹҹҶѶѳҳҳҳҳҲѴѴѴѴѶӶӷҶѶѶѶѶѵеггдѳгҳҳгвϳгггвϲϳббббаϰϰϰϰϰϲϱίίίίίΰϯίίίίήͱαΰͰͮͮͧȠʩ̩̯̯̱̱̱̱̰˰˯ʰ˯ʯʯɯɱɱɱɱɮȮȬȫǪɪɪɪɫȪǪƩūƫƫƪŨŧħĦææ奧§¦~~~~m%FM          !     (&  %&   ! #&#&# $$)%,EAOfbn{~~~~~~~~}}}}}|}|~~~~~~-?/()#.,ԥíȲͱβϴѵҶӶӶӶӶӶӶӶӴӴӳҳҴӵԶյԸӸӹԹԸӸӸӸӷԷԴӴӷԶӶӷԸӸӶӶӶӶӶӶӹѹѹϹϹѹѷҷҵҵҵҴѴѴѵҴѲӲӲӲӴӴӴѴѲѲѳҳҳҲѲѲѲѱбϱϱаϰϰϰϱггббаϰϰϱвϲϳδϲϱβϱαααααΰͱΰͰͰͱΰ̬ͮͮͭ˫ʫʬ˭̯̰̯̲ͯͱ̱̰˰˰˯ʯʯɯɯɯɯɯɯɮȬȫǪɪɪɩȫȪǫūŪūƬūĪũħħĦ奥¥¤~~~~mZwUtySrw[rt^uw^st^st`trausausauscvwexyl}|l}|jzwn~{n~{n~{qrtxxrjz}iy|l|m}puvrtxsm|gx~m~k~ltzxrmr|}~~~~~~~~1<@7BF;HNQ^dXioctzk|qzTd_1A< ''%.2(,$<9;XVVtrrzsstvvrstvy}Ǵ̷ҹԷԷԸոշӸԷӷӵԵԵԵԵԵԷԷԷӷӹӸҵѶҴӳҳҳҳѳѳѳ߳Ɲ%%%FFF526%"&bjjڱ­dzͳͳ͵зҸӸӸӸӸӷҶӶӴӳҳҳҳҳҳԴնӶӸҸҸҸҸӸӵԵԴӴӹԸӸӸӸӸӶӶӵҶӸӸӺӺӹҹҷҷҶӶӵҵҳҳҲѲѲѲѲӲӲӲӲӲӳҳҲѲѳҳҳҳҲѲѲѱбббаϰϱббббггвϲϲϲϲϲϲϱβϲϲϱααίίίίίίίή̮̮̰ͯͮͳгЮ˭ʮ˯̯̮˯̯̯̱̰˰˰˯ʯʯʯʮȯɭɭɫʪɪɩȬɬɫȫȪǪǫūūūŪũĨŨŦæ奥¤¤~~~~}}}~~}}}}~~~~0=A5BF9FLQ^dZhpes{m|t|  ".)-94+72*53#.,$"  4:9wrmhz}hyj{morsux~ưȶѷҷԷԷԷԷԷԷӷӷԷԵԵԵԵԷԷԸӸӸҸҶҶҴҳѳҳҳҲѴѷ泿8=@&&'##-) snwţ}«ƭȰ˱βϳдѵҵҸӸӸӸӷҸӶӶӴӴӳҳҴӳҶӶӶӶӶӶӶӶӷԶӸӸӹԸӸӸӸӷҵҶӶӶӵҶӵҵҷҷҵҵҵҵҳҳҴӳҲѳҳҳҴѴѴѴѲѳҲѲѲѲѲѲѲѲѲѲѲѲѱбвѱббггдѳееееедϲϲϲϲϲϲϴϳαβϱααααααΰͰͰͰͰͮͯίέ̭̭̭̭̱̲ͱ̱̳̲˲˱ʱʱʯʯʮɮɭʬɪɪɩȩȫȬɫȫȫȪǩƩƩƩƨŧĨŦ奥¥§¦¤~~~~}}}~~}}}}~~/>D5DJ8KRM`gThs`tl}s{ #/)/;5-93*60.73)2. $#PV[rmh}~ez{auzfzi~kpppq~°dz˵͸йѹѹѹӹӹѹѹѹѵӵӵԵԵӵӸҸҸӸӶӶӶӶӳҳҳҳҵһꞩ "&%)-,#)0#)0%). $),,,EEEooo}éƫȮ˰ͱβϴѵҵҸӸӷҷҷҸӸҸҶҵѶӵҶӶӶӶӶҷӷԷԵԴӴӴӶննӶӸӹԶӶӴӴӴӳҳҴӳҲѶӶӶӵҴѵҴӴӴӳҴӴӴӳҶѶѷҷҳҳҳҲѳҳҳҳҲѱбвѲѱвѲѴѳгггҳҶѶѵееевϲϰϰϰϰϰϰϱͲαͱͱͱͱααͱͰ̱ͰͰͰͰͮͯήͮͭ˭ˮ̯̯̱̱̰ͭ˰˲˲˱ʱʰ˯ʯʮɬɬɪɩȩȩȫȫȫȪǬǬǩƪǨŨŧħĦæ奤¥¤~~~~~~~~~~~~~~~~~~~~~~~}|||||~}}}~}~~~~.@C5GJ5OUJdjPku[vgmy} (2=;,75)03(/238;.36!"+(1%/?'89"/3)- #   ?LJ}ȯʱ̳ε϶зѸҸӸӹҹҹҺӺӹҹҺӺӹҺӺӸҸҸйѷԷԴӴӴӴӶӶӶӶӸӹԶӶӴӴӴӴӴӴӳҴӴӴӴմնӶӳҴӳҴӴӴӶӵҶѷҷҷҵҵҵҵҳҴӳҳұвѲӲӲӲӲѲѴѳвѳҳгежѴϴϴϵггаϰϰϰϰϰϲϱαααααααΰͰͱαΰͰͰͯίά̭̭̯̯̰ͬͬͫ˰˰˱̰Ͱ̮ͮͮͭͫʩȪɪɩȩȩȩȭǭǭȬǫƬǫƪŪũħħĦæ夤~~~~~~~~~~~~~~~~~~~~~~~~~~||||}}}|~-BD7LN;R[OfoSmz\vfkw{*/99 ** ,#)5*1:!(1""54A9@Pmtqoe}{c{yayyc{{e|~g~ikpqzʾӻѺзӷӹѹѻѻѹӹӵӴҴӵԵԵԵԴӴӴӶӶӸӸӸӸӸӸӻۄ +4#:@?8>=389278.36$),!%  MZY˥~ưȰʴζϸѹҹҸӸӸӷҷҷҶѶѷҷҷҷҷҸӸҸҸҸҷԷԷԶӸӸӸӸӺӺӺӻԺҺҺҺҸӸӸӸӸӸӹԹԹԸӸӸӸӷҷҸӷҸӵҶӴӳҳҴӳҴӵҵҵҵҵҵҵҴѴӴӴѴѴѴѲѱббббеееееегвϰϱаϱаϰϲϱααίίίίί̱ͮαααααήͯίή̭̭̯̰ͮͭͰ̱̱̮̫̬̬ͯͭͭ˪ɪɪɩȩȩȩȩȩȩȨǨǪǩƪŪũƩƧƦť¥£££¢|{|{||~~~}~~}~~~~~~~~~~~|||||}~~~3EH8JM?)./(%/,)3*'1$!+#!%,'^mٙ~~®ű˳ʹζиӸӹԸӹҸѸѹҶѶѵҵҴѵҷҸӺҹѺҺҹԹԹԹԹԹԸӸӻԻԻԻԻӺҺҺҺӻԺӺӸӸӸӹԹԸӸӸӸӸӸӸӶӶӴӴӴӴӴӳҶӶӵҶӵҵҶӶӶյԴӴӴѴѴӴӲӱҲѱббееееееггаϰϰϰϰϰϰϯίίίίίίίίίίααααίίίήͮͮͰͰͰͰͰͰ̮ͯˬˬˬ˭̬˫ʪɪɫʪɩȩȩȨǨǨǧƧƨŨŧĨŧħĦ姧¤~~~~~~~||{|||~~}~~~}}~~~~~~~~||||||~~0IK7PR@Y]SlpYr{b{kp{l~ ' +:9+:9':;':;!0/'&$&*roey~cw|bv{cw|exgzh{h{n|rz~¾ջлйѹѷӷӵԵԳԲӳԲӲӳԲӲӴӳҴӴӳҳҳҲѵҴ쬴CK=/757;"$($+ *)  ' '!%&$*֗}||~ij̴ͲϴѵҶӸӸӹҹҷҶѴӴӴӴӴѵҵҶӶӶӸҸҶӶӶӶӶӷԷԷԹԹԹԹԹԸӸӸӹԸӸӸӸӸӸӹԸӸӸӸӸӸӶӶӴӴӴӴӴӳҵҵҵҵҵҵҳҳҳԳԴճԵԵԵԴӴѵҴѴѳгггдӳҶӵҳҳұҰѱббаϰϰϰϰϰϰϰϯίίίίίίαббαγβͲͲͰͰͰͰͰ̯̯̮ͯ˯̬ˬ˭̬ˬ˪ɪɪɪɩȩȩȨǧƧƧƧƦŦŦŧĦææ奧§¦~~~~~~~~~~||zzyz{{}}}}}}}}}~}}~~||||||~~/<@0AB(9:!*-"% 206͚~}sv{~ʿѿѻһҹҺӸӸӶնյҵҹҹҹҹҸӸӷҸӸӷҷҷҵҵҶӶӷԷԷԷԷԷԵԴӴӴӴӴӴӵԴӴӴӴӶӶӸӸӸӸӶӶӴӴӴӵԶӷԹԸӸӷҶӶӳҳҳҳҵԵԵҵҵҴѴѵҶжзѷѳҳҳұббббаϰϰϰϯΰϰϰϲϲϲϲϰϰϰϯίίίίίίίίαͱͱααΰ̯̯̰̭̭̬ͯͭ˭̭̬˪ɪɩȩȩȩȩȪǩƫƪŪũĨŧħĦææå~~~~~~~~~~~~~}}}}}||}}|||}}}~~}~~~~~~~}}~~~~~}}XppYqqZrrayyj}~nu|(4/&!%--,53.75)03%( 2<<vn~ez|dy{`v{_uzat{^qx\nyWitXhrfvszʺѵѵѷԷԹӹӹӹӶӶӴҵӴҲабѱұұҰѳҳҲѳ3//99:<<=;>?589,,-##$! _^kә|xsv~˿ѿԾӹҺӸӸӵҵҵҶӷҷҷҸӵҶӵҶӵҶӵҵҳҳҴӴӶӶӷԷԹԹԷԷԴӴӴӴӴӴӴӴӶӶӸӸӸӸӸӸӴӴӴӴӶӶӸӹԸӸӸӸӴӳҴӴӴӳҴѴѵҵҷҷҷҷҷҷҷҷҵҶӳҲѲѱаϰϲϲϲϲϲϱβϲϲϲϱβϯαаϯίίααααααΰͰ̭ͮͮͮͭέίΰϯ̯̯̮ˮˮ˭ʬɫȫȫȫȪǪǪǩƪŪŪũħħĦæ秦~~~||||||~}~~}~}}~~~~~~}~~~~~|||}}}cz|e|~f}kquĬN_Q "('3&,60,60)./$%),-wod{}by{^uw]tvZpuVlqPenPenL`kYmxn}{´˸ѺӵԵԴӴӷԷԸӶѵϸҵѴвгѳҳҳѳѲвдζ`PR 7')96:EBFCBF87;-,0"!%" ˴̗~xurr|ǹϽԻҹԺննմӴӳҳҵҴѵҶӴӴӴӳҴӳҳҳҳҳҳҳҵҶӸӸӶӷԶӷԴӴӴӴӴӵԷԷԸӹԸӸӸӸӸӸӸӸӶӶӶӶӷҷҷҷҴӴӴӳҴӴӴӳҴѴѴѴѵҵҵҵҵҵҷҶѷҶѴѴѲѱббвϳвϲϱβϰϰϰϰϰϰϲϲϱααααααααΰͰͰͮϮϮϭέέέ̭̬ˬ˫ʫʭʭʭʬɫȫȫȪǩƩƩƨŨŨŦæäää㥥¤~~~||||||}~~}}}}|~~~~|}||}}~~~}}}}}}~}{|||||}}~]r{`u~dykk}nw|}~}%# ("':4)<6)<6':4!.2%)"! &+,rmc|~_xzZuyVquWkpSglQ`fM\bJU`[fqhw}v}Ŵ˹жҶҴҴҵԶշӳϳ˳˶ζβгѳҳҳҲѲвдι.0+ $""812B;D=W]MchMchD[dTktVsLiu-J\ (:'5CVdkx~y|%"2>8:EC;FD1=7,82*/0 %&!'-2pnd}_x|XswTosNdiH^cEV]ARY?ARSQ^b\im[jvWfr?Tc 5D $ =99eaaxxy~~~v6A?5>A#,/+427@>/77''$;:H;:H48J~nl_}~[yzYuvSopLacEZ\ERX@MS:DLLV^^ltm{v}ħȸӹԶӷԷԶӵѴг̵ιиϷѷѳҳҲѳҳҲѳѼܣ)  8D?3?:.=61@9176*0/'"+"&  ŭ˜xt~pzmwlv~v|dz̸йѸҸҴӴӳҴӴմմյֵԵԴӴӴӴӴӴӳҳҳҳҵҶӷҸӸӸӹԸӸӸӸӹԸӷҸӸӺӺӺӺӹҹҷҸӵҵҳҳҳԴմӴӴӴӵҵҵҶӵҵҵҶӸӷҷԷԷԷԵյյյյԵԵԴӴѴѴѳгвϲѲѲϲϴϳγγγγγгаѱҮϮϭέίίαααаϰϰϭέή̭̬ͭˬͬͬ˫ʭʭʬɫȭʬɪɩȧȦǦŦťĥĥĤä㣣£ġ¡~}}}~~~~~~~~~}}}}}}}|~~~~}}~~{|||||||||zz{zyyxyyy{{{{}}||||{{||||~~~+$&+$&+(*524@A>GHEHMNOTUT[^bilaoyIWa#7B---JORinqmztw{v 7@>/5:-01;>?644$""!$LFQPJU36Dnkd}^wyYrtPikIZ[?PQAIP@HO=CJPV]^kqn{t{ŨĬȳζѹԹԷԶӳҳҳѳѶҵѵѵѳҳҲѳҳҲѴכ*"=FB7@<8D?9E@073'.*%$( # ɧxrnzjv~gqylv~ov|ëůɵͷϹѸжҵѶӶӴմյֵֵԵԴӴӶӶӳҴӴӴӴӴӶӶӷҸӸӸӷԶӶӶӶӷԶӷԶӷԹֹֹԹԹԹԶӶӴӴӴմմմյҵҵҶӴӴӳҳҳҴӶӵҸӸӸӷҵԵԵԶմֳճԳԳҳҲѲѱаϱұҰѰѲѱгδϴϳγγαбЯаѯЯЯЯЯίίίΰͰͯίίίΰ̯̮ͯˬ˫ʫʫʪɩȭȭȬǬǪǨŦŦťĥĤ㣣££¤ã£££¢~~~}}|~~~~~~~~~~~}}|||||{|||||||||{||~~||||||||zyxxxx{z{{}}}}}}|}}}}}}~~~~~~~~ &+$*/(15.7;1>B7DH;MP?QT287 &%(+",/&+$&"*/2}lic|~^wy\qsOdfDTW;KN8@M6>K7?LKS`[gojv~ry©ŬȲʵ͸йѷԶӴӳҳҳҵҵҵҵҳѳѳҳҲѱд͂&#>BA154)+0.05,)2%"+#%#%$#' Τ}pznxhrzbnveqyl|syƯȲʵ͹ѺҵҵҷԸչַֹԶӵԵԵԴӶӶӶӶӶӶӶӶӶӶӸӸӸӹԷԷԴӴӴӵԵִֵմշַָӸӸӸӷҸӸӸӶӶӶӶӵҵҵҵҶӵҵҵҶӷԶӶӶӶӶӵҴӵԴִִճԳҳҳҲѲѱбббббҰѯίαααααααααбЯЯЯίίίααήͮͮϭέέή̭̬ͭˬ˫ʫ̪˪ɩȩȨǪǪǩƨŨŦæèť¥££¢âá ~~~~~~~~~~~~{zz{zz||{|||{{||||||~~~}~~{{{|{{|||||}}}}}~}}||}}}|}~}~~~~%%%)))-.+230777:::8<;487,14!&) $-&'4-.628:6<206317:,<9%74#52'+#/77ylg~ayy\tt]mpO_b@QP6GF7@C8AD7?FEMTWckht|qxŮȱɵͷиѹѺҶҶҵѵѶѶѷҷҴѴѲѲѱбдbrg$'3C>.D<,B:/."! JWVzlf}ayyZrrXjmK]`?OL5EB3@?3@?7>G?FOWYclnxu|~~ðƱɳ˶ηϸйѸҷѵѴвѲѴѴѴѴѴѴѴѳж?MH ";DB.75%#ù͝wkxwguwaoq_ip]gnkvztx«ƭȯʰ˳εеѵѷԷԶӷԶӷԵԵԵԵԵԵԵԵԵԴӴӴӴӴӵԵԷԷԷԷԵִմյִִִִֵ״ֳִִԳԳԴմӴӴӴӵԴӴӴӳҳҶӶӴӴӴӳҷҸӸӷҷԷԷԷԷԷԳԳԳҲѲѲѱҲӱвѱббұҰѰѰϰϯίίЯЯЯбѱѯЯЯЯЯЯЯЯЮϮϭέέ̭̭˭ˮʭɮɮɬɫȩʨɧȦǨǧƩĩĩĨ奥¥£¢~~~~}}z{zzzzzy{|~~~~||||{{|{|||||{{{|{|||{|||}}}}}}||{{|{|||}}}~~~~~~~}}~~! $$#')&*+(,,&+*$)) '%#$! #%*-%04)48+8>/D2AG;DGHQT_bcnqrx}~=MP )266?B7@C5AC2>@'-2#\dqymh}bwy]rtZklK\]?LK4A@1;C0:B7<3@>9AA="&%8EC5B@,C?.EA!75,* +:9˨đxr}ept_jnZeiWahR\cXcgjuyzŮǬ˭̯ΰϲѳҶӶӶӶӵԴӵԵԴӴӵԴӶӷԷԷԷԷԷԶӴյֵԵԵԵԵִֵֵֵմնշִֵֵմմմմմմӴӴӴӴմյԴӶӵҶӶӴմմճԵԶննմմճԳԳԳԵԵԴӴӲӲӲӲӲӱҲӱұүаѯаѯаϯΰϯίЯЯЯЯѯѯЯЯЯЯЯЮϮϬ˭̭̬ˬ˫ʫȫȫȪǬǬǩƨŧħĦæ秧¦~~~~~~~~~~}}||zzzzzy{{{{{{{{||{{yyyxxxxxzzz{{z{{zz}}}}{{{{|{{{{{{{{{{|||}}}}~~~%!$ !  "!%*"-1&15%58(8;*:=/?B6CG=JNBMQP[_`kojuynxAKE 1549;?;=A9>A38;)+/!++,ul{ix~etz`ouVijFYZ3@?'4314B14B07@5JOPlqrĭDZ˴ϷҴѴѲѲѳҲѱвѱббвѲѱбаϸ4=;AED>BA5><097+25!(+"  Ta`ͬyr{enr]hlVaeN[aFSY>IMT_cqz}íȫȮ˳гдѴѷҷҶӷԵԵԵԵԴӴӷַֹԹԹԹԷԶӷԶӵԵԵԵԵԵԵֵֶַַնշԷԵִֵֵֵմմմնӶӶӶӸӹԸӸӸӸӶնննյնָոննմճԳԳԳԳԳԲӲӲӴѵҲѲѲѱвӱұҰѰѰѲϲϰϰϰϰϯίαααбггббЯίήͬ˭̭̫ʫʫʪɩȩȨǨǨɧȨǧƧĦæ奣¦~~~~~~~~~}}}|||zzyzzy{|{{{{{{{{yyxyyyxxzzzyzzxxxxxx{z{{{z{{{{{{~}|{|||}|}}}}~~|}}}}}~#! &&&%,/)03&46)79+;8.>;5BA;HGBMQMX\Xekcpvgwzqx~;D@ (1/9B@7B@;FD9DB/:8&+."526w}hx{eux_tv^suUjkCXY.<>*8:/2@/2@17<5;@9?D5;@7>AQX[{©ĭȱ̳γβϴѲѲѲѱббаϰϱбаϰϲϱι飣%%%$""=?C:<@29<07:+25 '*! NVVʭvo|{_lk]fiU^aOUaGMYFMVELUU\_­ƭȰ˳γεжѷҷҶӶӴӴӴӴӴմյ״ָֹչԸӹԸӸոշԷԵԵԵԵԵֵֵֵֶննշִյִմմӴӴӴӵִշַַԷԸӸӶնմִִִִճԵԶմմմմճԴմճԳԳԲӳԴԴԲԲԱӱӲӱұҰѰѰѰҰҰѰѰѰѰѰѰѯббгѳѱбЯЯЮϭά˫ʪɪɪɩȩȩȧƧƩȨǧƦŦæå~~~~~~~}}}}}||||{{{{{{{{{{{{{{{{{zz{zzzzzzyzzyyyzzzzzzzzzz{zzzzz}~~~|}{|{{{||}}}}}}~~~~~~    %%%'-,,21%35(68*98,;:5??;EEDJORX]Vci^kqbsyizqv~OKDJF?NJCALCCNE;FD.97 ),"A4:z{yerxbou`ouetz\mlGXW/=?)79-3@,2?.7;09=5>A9BE7??;CChqoìǯʱ̲ͳггггϲββΰϯΰϰϱαγβͺ삈 2225:C38A28?06=*14 '*!=EEƩtn{z]jiYbeOX[JQZFMVHOXDKT5>Aluxªŭȯʳ̵θѹҷҷҵҵҵҵҳҳҳҴӴմոոչҹһԺӹԺջԻԷԶӴӵԴӵԶӷԹָննճմִִִմմմմյֵԵԷԶӵҵҴմմմմմյԶյҶӴճԳԳԳԴմմմӴӲѲѲӳԲӱҲԱӱӱӱӱӰұӴӳҳҲѰѰѰѰѰѯбббббααΰͰ̫ͯʪɩȩȩʨɪǩƨŨŧħĦťĥ¥§¦~~~~~~~~}~}}~}||||{||{{{{z{{{{zzzxxyyxxxxzzzyyxyzzzzzzzzzzzzzyyyxyy||zz{{z{|||}}}}}}~}~~~~~~~    "%&$-1'04%28'4:'7:)9<,;A3BH9ISGWaQakXhr_oyeum}ry7;::::AAAA18A'.7$-"  6/6[ZWqpmgptbkoYfrYfrS^iHS^6@G)3:)1>(0=*4;,6=/9@3=D1<@0;?U`^p{yįɰʲϲϱααͱͯͯͭέά̮ͫ˰ͳγ{*(5B@2A@1@?1<:/:8*0/ &% YYYϮ~rkx|ZgkS^bHSWBLSBLSCNYCNY:JMBRUpzêŭȰ˳̵εйԶմӵԵԴӴӴӴӴԵյմԵԵԴӵԷԷԸչָӸӸӸӸӸӸӹԹԹԹԹԷԶӴӴӴմմֳմִִֵյԵԶӶӶշִմմմմӴӴӴӴӴӴմմմմմմӴӴӳҳҲѲӲӲӲӳӳӳҳҳҲѲѳұұұвѰϰϰϰϯЯгӱѱббба̮ͯˮ˭ʬɩʩʩʨɩƨŧĥ¥ĦťĥĥĤäã¡~~~~}}}}}}|||||{||{{{zxxxxxxxxyyyyxxxxyzyyyyyyzzzzzzzzzzzzyyyyyyzzz{{z{{{{{||}}}}}}}~~~~~~~~~~   %&#)-,.21'35)57&78):;->?2CD:JMHX[Q[b[elboshuyj{pzyO]_ &%3*+5,-9*0<-31,5'"+#,**LJJaabeefZ]eWZbUY^PTY7AH,6=%0;&1<)48*59.7;2;?:@G=CJJT[]gnt¯Ȱɱ̰˱̰˰ʰʰʰʮˮ˭ʬɰȱɲʺjoj  ;?>HLK8EC3@>.?@+<=$-0$'#PBD{qfwxYjkN`cBTW?NT=LRAKSEOWGQY@JR[do|¬ůȰɴͳεзҵеееҵҷҷҷҷҵҶӶѶѶѶѵжѸӸӹҹҸѸѹҹҹҹҺӻԹԹԷԶӴմյִճմֳճմִֵֵַԷԶӶӴմյԵԵԴӵԴӴմմմմճԴմմմմճԴճԲѲѲӲӳҳҳҳұұұұұұұұҰѰѰѰѰѰѯЯбΰͰͰͲͱ̮ˮ˪ɩȩʩʨǦŨŨŦ奥¥¥¤|{{{{|{|{zzzzzzzzyzzzzz{zzyyyyxxyyyyzzzzzyzyzzyyyyyzyzzzzzzzzz{z{{{|~~~~}~~~~~~~~     "%&#--(22%35&46%67):;,=>1BC:IOGV\K_dSglYpr^uwj|vn{.88 ""%" 1$"3)# NOL[\YKU]IS[EUXAQT3CF%58#1;#1;%26'48*7;,9=0>F/=E=MWRbll|zƬǫȬɬɫȫȫȫȬɬɬɫȫȫǫDzmvy-10 :::HHH:?B6;>38;169,,-""#"OKKzrjyxZihS`_KXWDNU?IP?HSCLWGO\EMZY_lrx«Ưȳ̰̱ͱΰͱбггеееедѳбҰѰѱҳұбгҲӱұұҵҵҷҸӸչֹԹԷԶӴӵԴմոոոִִִָմնӶӸӸӴӴӵԵԵԴӵִմմյִմӴӴӴӶӶӴմյֳԳղԲԲԲԲԳҴӳҳұұұӱӰҰҰҰҰүѯЯббаϰϮϮϭά̫ͬͫʫʪɩȩȧƦťģģģģĢᣣ£¡~~~||||{{yyyyyyzzzzzzyzzzyz{|||zzzzyxyyyyyyyzzzzyyyxxwwwxzyyyzzzzzzzzzzz{{{{{||||||}~~~~~~~~~||||}}}~~     $' ,.$02"34#45$56(9:-:>2?C:HPGU]I\cPcjYmr_sxg|~y})87$-+*31-/-/.+"2/%50*:5&31#!   99:IIJ@JQ?IP=LR:IO2AG(7=#19"08#36%58'7:)9<.::}t}kxw[hgR^`HTVBLT=GO@FSBHUEMZ?GTR\djt|y«įȱʮ˯̭̭̭έΰϰϲϳгвϱбЮЯѯЯббббаѰѯЯббббвѴӷԶӶӷԴӴӴմմմնննննӶӶӶӶնշԷԷԷԷԷԵԵԵִֵֵմӴӵԴӶӶӶӶӶյԳԲӳԳԲӲӲӱұӱӱӱӱӲԱұұұҰѰѰѯЯЯЮ̯̮ͭ˭̭̬˫ʪɩȨǨǧƦŦťģĢâá¡ ~~~~}}~~~}{||{{{zz{zyyzzzyyyxyx{z{{{|yyyyxxvwwvxx{{wvvwwwyyyyyyyyxyyz{{xxxyyzzzzz{z{{{{|}|}}~~~~~~~~~~~~~~~   ###"+)(1/%21'43(46+793:=8?B>GJJSVL[aUdj\loaqtm}s`on -868IJ>/77-55+33215215415526<<<199088/86-64+40%.*%#!!b^^xyluy[dhQ^]ERQ=LR7FL7EO9GQ=JVANZIVb`myn~xéĩƫȫȫȫʭ̭̬ˮˮˮ˯̯̯̬ˬ˭̭̬˭̰˱̲ͲͰϰϬͬͪ˩ʪ̮аѲӳԴննճҴӳҴӴմշֶմմմյַԷԷԷԷԷԷԷԷԷԷԷԷԷԷԷԵԴӵԵԴճԴմճԳԳԳԳճճղԲӲӲӲӱҰѰѱҰѰѯЯЯЮϮ̬ͭ˫ʭʭʮ˭ʬɫȨŧĥĤä㣢~~||||{{|||||||{{{zzzzyyyy|{yyxyxxxxxyyxyyyyxxxxzzzzzzxxxxxxxxxxxxxxzzz{{{{{z{{{zy{{|||||}~~~~~~~~~~~~~~  !!!"+)'0.%13'35'35*68/:86A?=GGFPPNY]XcgZjmaqttBRO3;3=@A/23+$+*#*1"(2#)4")5#*5#+3!)-")9.5=<@215" #*&$3//95575;86<15:-16%13$02#13#13%26'48)9<,A49<6;>17<17<3>B3>B+6:%)!!<79{z~luyZcgO]_CQSLVGU_^lvl{v~ĥħƩȬǬǫƭȭȭȭȭȯȯȯȯȭȭȭȭȭʭʯʯʰɰɬɪǫȭʪɪɯ̰ͳδ϶ѷҷҸӷҷҶӶӴմյִմֵ׵״ֵֵַԶӷԶӶշַԷԷԷԷԷԶնյִֵֵֵմմմճԳԳԴճմֳճճձӱұұҰѰѰѰүѯЯЮ̬ͮͭ˭ʬɭȭȭȪŪũħĥ¥¥¥¤~~~~}||||{{|{{{{{zzzzzyz{{{{{{yyyyyxyyxxyyyyxxxxzzzzxxxxxxxxxxxxxxxxxxzzzzzzz{yyyx{{|{{||}}~~~~~~~}~~}}~~~~~~~~~ !#)((.-$02&24'35)57/995??>FFHPPQZ^Ybf]ikgsur}{7B@  .3.2+,(**+ + -",")%',!"0%&   '%.+'41-223334-25*/2"/."/.0/ 10"34#45(9:+<=6IJFYZXhreuqyљ !+))FDD;8:4139.47,2;)0=+2=,0@/3=45B9:DHG487""# gbdwcsvTdgL[aAPV;IS6DN5DJ7FL>HPCMUJU`]hsjyu}©¬ŬŬūĭƭƮǭƭƭƬŭƬŬŭƬǬǬǬǮǯȮǬŮǭƭȭȩȫʫʬ˯αдѵҹҹҺӺӶӶӶӷԵִյִִֵֵֵַԷԴӴӵֵֵֵַԷԹԹԹֵַַֹԵԵԴӴմճԴմմմմմմղԱӱӱӱұҰѰѰѯЯЮϮͬ˫ʫʫȫȫƫƫȩƩƨťĥĤäã¢~~~~}}|||||||{}}}}{{zzyz{z}|||z{yyyxxxvvvvvvxxxxxxxxxxxxxxxxxxvvvvvvxxxxzzzzzzzzzzzzzzzzyyzz~~~~}}|}}}}}~~}~~~  ! *,!-/ 12"34 25"47(8;.>A8CG@KOKU\T^edprmy{IVT3@>'81):3-?<2DA/A>.@=+?=-A?-A>-A>,@=-A>-?<-*    "!#'&"-+#.,"-+ +)+),*/, 0-"10%43)57-9;5BFCPTTcicrxo|w~(# (1 !'& &%#*&$+'&)!%( $'%(") '!#!!  fnnltt\ioTagHY`?PW9GQ3AK4@H6BJ8CN;FQFRaWcrdso~y¥¦¦æ¥¥¥¦ŧƨǨǫʬ˭̯αгҲӳԲӳԵִնշֶӶӵֵֵֵֵֵֵԵԷԷԹԹԹԹԵԵԵԵԵԵԵԵԵԵԷԷԵҵҵԵԴӴӴմճԳԱұұүаүѮЫ̪̩ͪʨɦťĥ¥£¢}}~}||||{{{{|zzzyzyxxxxxxxxxxxxxxxxxxxxxxxxxvvvvvvwwxxxwwwxxxwwwwvwwwwwxzzyyxxxxxxwxxxxxxxxxxyyyzzz{{|{{{||||||||}}}}~~}}~~~~~~~~       %$(,+/$/-&1/&31'42-862=;;CCDLLLUYW`daqtfvyASP/A>1=8,83278389888777888:::6:96:93983983><#.,  !%'"&+'(-)$+'$+' ,' ,'"-+#.,$/-'20'42,97*><F5AI:EI?JNGP[[dofsp}x~¦§©«ĭƮǬɮ˰ͳггдѵҶӷԷԷԶӶӷִֵֶֶַ׵ֵֵԵԻԻԻԻԷԷԶյԵԵԵԵԵԵԷԷԷԷԵִֵյִմմֳճԲӱүаЯϮά̫ʪɩȨǦçĥ¤~~~~~~~~||||{{{{{zzzyyyxxxxxxxxxxxxxxwwxvvvvxxxxxxxxxwwwxwwwwwwwxwwwvvwwwwyyzzzzwwxxwwzywwwwxxxxxxyyyzyz{zz{{{{{{||||}}}}}~~~~~  %)!*..- 10 42!53&76+<;4DG;KNGU]O]e^ougx~?OL+;8+40+40/,5/,52+43,53,33,33,54-61+60*5.+/&#'  $#"'*"'*!&'"'( ((!)),+,+-/"02#45(9:0@C>NQSbhapvj{ryY]\ !%$598-775??6@@7AA7@C7@C7B@6A?4B=3A<6FA7GB%0." "!!"IKOUW[QUaTXdIT_BMX:FN3?G1?G3AI6EK9HNDQ]Ubner~p}z~¥¦å§ĪǬɫˬ̨Ǫɱβ϶ѷҸոյִմӳҲԳմشص׵׵׵״յַַַԷԵԵԵԵԵֵַַֹԹԹֵֵֵֹ׵׵׵׵״ִմղӱҰүѭϬΫͩ˨ʦȥǤƣģġ ~~~~~~~~}}||zzzyyy{{{zzzyxxxxxxxxxxxxxxxwxxxxxxxxxxwxxxxxwwwwwwwwwwwwvwvvuvvwvvvwwxwvvvwvwwxuuuuuvxxxxzzxyzyzyzzz|{||||{{||}~~~~~~~~~~~~||||~~~~~   %%%***#--%//%20'42(53.;98ADCLOHU[Q^d\mtct{:LI%74'3.$0+***))).').')0'(1()1()0'(.&+.&+'$($!%   $#&#%'$&%%&%%& %("'*"),"),"-+%0.(31,757>AHORS`fbouhz}qx~5:6'+*487.27-160-6/,53.72-63.74/83-80*52.;2.;'%+#!!$# FAJNIRMMWPPZKO[EIUG4>E6@G9CJ9CJHP]X`mgo|rz|§ĩƫȮʰ̯ˮʲ͵жϹҺӺӸոմղӰѲӵ׵׵׵׵׵׵ֵֵֵֵֵֵֵֵֵֵַַַַַַַַ׵׵׵׵׵״ֳճճհҮЮЬΪ̪̩˦ȥƤţĤţ¤ß~~~~~~~~}}}}}|||||{{z{{{zz{{zzxxxxxxxxzzxxxxwxwxxxxxxwwxxxxwwwwwyyxywwwwwvvvvvvvwvvvwwwvvvvvvwwwwwvvvwxxzzxxxxxyyz{{|}|}{|||||~~~~~~~~~~~    %%%***'-,)/.&1/'20*36/8;9?DDJOLRWU[`\lodtw6JG$85"2/.+#(+ %('$('$()#()#()#()#('#)&"(#!'# "$'"!"%"&'$(%%&%%& %(!&) &+!',!*-#,/)11-5529I>GRIQ^PXeZiocrxnEuNxPzZZ`erx~~~~~~~~}}}~~~~~~~}}{{zzzzyyyyyxzzzzzyzzzzzzxxuvuuuvvuxwwwyzyyvvwvwvvvvvuvvuvvttttttttwvvvvvvvvvxx{yxwuuxyyzxxxxxxxywwwwy{}}{{{{~~}~|}}}}}}}}}}}}}~}~~~~~~}~|||~~        #% +-(%.,&/-%.1'03-23389;=AHJNKTXS\`]lkdsrBLL3==);8$6333111122/2/2,2.4/5-3/5-3*..244((    "# $%""%&"%&&)%('))++-!-/&/2)25.7;AJNM[e^lvewzpv| &%398'-,$&*"$(#!' $""! "$"$" !!!#"'*!36-:=4>>?>>?:?B;@C6BD7CE3CF4DG5EH8HKCMTT^ednvpzv|¦èŪɬˮͮͰͱδ϶ѹԹԵԵԳ׳׳׳״׳ֵֵֵֵֵֶ׶նճԳԳֳֳֳֵֶ׵ֶ׶׶׵ֳִֵױְլҬҮԪШ˫ΥѠ̖vpnld]?t@uAzE~F{CxEzg~ClIoCi7i8j7pAEJMKRUT[^_kmiuw;ID-;6/C9,@6$<4":2#>3&A6$<4'?7(>6,B:/F:-D8-D9%<1";0)B7,C70$   !"!$#$' %(!&)!&))(*)*,!-/#.2(37*9?=LRO]g\jthw}ry~'%-:8,*#%')%)$("&"&"%!$ $ $ ' ' $""%$'#! '(%.2137628=17<19@3;B5>A7@C6BD8DF5EH5EH=KSO]e_lxkxv|ĩƬɭʬ˯αααβϵԴӵֵֵ׵׶׶׶׶׵ֵַַָչֶַַյԳֳֳֳִ״׶ص׶ص׵ֲֵճֱױ׬ҭӰ֫ўǕiXyVOxHvR\bpqttrrrruvvwywqogffddaaX|?lv;hr(av%^s#\r#\r+]s=ocl~~~~}}}||||||}}}}}|}}{{xxxxxxzzzzyzxwxwwxxxxwuuvuuuuuuuwwwvuuvvvvvuuuuvuuuuuvssstvvvwvvvvuuvvvvvvvuuuvwwwwwxxxxxxxxxxxyy{{{{{}}}~|||||{|||||{{{||||||||}}}||}  "!%('+$+.&-0%//&00)33-775>A>GJHPWQY`^lnhvx9KH/A>1D>/B<*<9);8*:5*:5-:8/<:1=82>95;:4:93983980=46C:2D:1'   "!#&$'&&&&(((((,"+/#-5*4<.<)42#.,$/-$/-#.,,+ -,-*-*-'-',),))'*("-+ +)%&&&+.//23,4;,4;-51:>3<@3=E4>F4BJ2@H:GSN[g_lxivw}¨êǬɫʮ̰ͯͱβϳҴӵԷֵԵԵԶն׶׷ַָ׷ָֹֹոննն׵ֵֶ׶׵ִֵֵֵֵֵֵزְدץИÌvpvytnpqrvyz{{}}xwxy{}}~~}wvrqpnqnoolia[OyIsBmBm/<;,981690583675898890012*/2*/605<6;9=<:>=/=8$    "!$##$$% %& %&$&*')-)/4.497FLDSYL^iXjucs}px~"&%9?>5;:%97$86"64!53#43#43#52!305.70 5/3-!30"41)96!1.'%"(%!/+)3/-223223.27/3834<45=56>89A<=ECDLCJSU\eckxnvv|§ĬŮǯȰɰ˲ͳδϴѶӶո׵ԵԸ׸׸׸׵׵׵ֶ׶׷ططض׶׶ضضطٶ׵ֵԵԷԹֺݷگ׮֢̖yiehq~||~}}zz{}}{{zxvqpkimrxvsrmniaP}Hu8iv0an4^r9cwPm]zr~}}|{{{{zzzzz|||{yxxxxxxxzzzyxwwwwwwwwxwvvvwwwwvvvvvuuuuuuuuuuuuuututuuuuuuuvvvuuuuuuvvxwwwuuuuuvvvvuvvwwxxxxxxxxxxz|zzzz||~~~~~~~}||}{{zzzz~ %"$)(,!*."+/#,0&/3*373:CLN7EG8BB4>>5:=38;169169167278278056.34/451:84=;3?:5A<1<3"    !"!!"""%"%$($(%,#)0$.6,6>;MWEWaLclWnwbu|muz&$;@<:?;7;:598145/23215215222222//////001112222222.3/).*$&!#'&*,+/+/4+/4*/8+09)/;)/;,2>/5A4?DGJMURU]_hlgptCLO:CF8AD5>A4;>18;1691691673891:81:8.97.970;92=;1><1><(83     #"!##%%'%'&)$+.(14,58=ORK]`QhqYpycy~kpt|%#9?>9?>318;058/4724857;49:5:;19908818;3:=1:>3<@-:9!    ""###&%('*"+.*31-64BROO_\Yjpbsyg{lsy|&$;?>;?>4<<199/69-47026026034034.43-32/32/32043043)50#/** %%%***,+/-,0,.2,.2-/4-/4/1646;8:FIKWPXe_gtdr|lzry¦èŪǫʬˮ˯̯бҰҲԳմֵֵֵԵԶ׶׶׶׷ططططظٵصش׵طۺ޾ۢɇwim}~ugGq},Vb,bsDzTXbd`^[ZZZagjPmy(4/32ajh{{opnnoprrtttsttjhcb`^\~Z|YzVwSr~Kjv?_h8Xa?`mTubdmryz~~~~~~~~~~~~~~}~}}}|}}~~{{{zzzyyyyyxxxxxxwvvwwwwwwuutuutvvvutttsssuuutuuuusrrrrspppprqttttttrrsrtutttuwwxxvussttutttttuuuuuvvwwvvwyzzzzzxxxxxxzz||||zzzzzzzyyzyz~~~~||yyyy||||{{{{||}~~       "#&%('*)) **#,/(14.9=7BF?ORIY\Ymk^rp:JG3C@;DB7@>6<;39817617616938;29<3:=29<29;;<37<15:/47-25-25-25-25.36.43-32222222223334-40(/+%$' ),"+.#,/#,0$-1%.2&/3)18-5<39FAGTPZb_iqhu{n{uzæŨǪ˫̫̮ϯѰұӴִյֳֳֵֵֵصش״׶׷طظٵصصش׵ؿܭՙ{jv{shQu4Xc'\i5jw8mzBwO{P|R|S}P}Q~S~U_hMbi ") $+'X_[orhkffjlmnlmmlrtkhdcbab_|^{]z\yZwWu}Us{QnxB_i5T`<[gVq{`{lswwxzzyzz{||||}~~~~~||||||~~}~}}||{{{{{|zzzyyxyyxxxxxxwwwwwwwwvwwwvvttttttuuuuttutuuuuuututtttrrrrqrstttttsttttttuwvvwwwtsqqpppprrttuuuuvvvvvvvvxxyxyyzzzyzzzzzyyyxxxxxxxwwwyz~~~~zzxxyyyy||zzzz{|}}~~   """!%$"&%(& )'#++(00065:@?ALJLWUXgfZih9EG3?A8?B7>A4=@2;>093?A+:9!      !! ! !$"%$(%))+!-/(4//;6IONW]\cjsrytvz'%5;:5;:18;.58-38+16-16-16.34056.43-32/23/23/23/23,36%,/%#   $ !($"+)#,*$+.%,/%--'//,0515:77ADDNSYebhtht|p|vzæũȪɫʪˬͭЮѱҲӶӷԷԷԶ׷ض׷ض׶׷ֶշַַֹغټ۾߻ܳݟɍppvqf}Tq};Xd<_lBer7br>iyBoDqJuKvRyT{\z^|k\u2BE%$(%$( '-,Ykhn}hjefhilmnnnnpphfca``^\}[|Z{Z{YzXzWyXxPpyFdr?]k8Ye:[gNlt^|nostwwxy|}}~~~~~~~~~~||zzzz||}}~~}}||{{{{{{zyzyxxxxxxxxxxxwwvvwvvvvvvwvvvvvvuuuwwvuttttttuuuttsttstttsstttsssstttttttvvvvtstsssssttttttttutwwwwuuvuzyzzz{{{{{{{{{}}z{yywwxxwvxy{{{|||zzxxxx{{{{zzz{}~"!$#%$&&(( (($,,//05569;@ACHKQVQW\?AK:1:=/8;06;06;26;37<37<37<39>4:?2;>7@C1<:     !$"$"%#$"$&%'&)'*,-./&31-:8FIJVYZolv|y'%7;:8<;29<07:.49-38+16+16.34/45.43.43/32/32/23/23-23',-"!#!(&*)+*+-!-/#,/$-0(15,5916?CHQTXdcgsir}t}y|æŨǧʩ̫άϭѮұӲԵԷַԷԶշֵصش׵شյַַֹ־ߴڤʆruzpj_{Qnx>[e?cn@dok}Dp~HtTu_rAU`*,! $#$'#&!&IYVp}hhdddeffgggfkmjfdbbba_`}^{^{^{\|ZzVxTvPu}Mrz/5/7>0::4>>-94   #)(.'-&'$(%&''('-&,'-)/3513"32&76;@AHMN\W`fajqnw{xt|t|ruvy|}{z~~}| &%999;;;98<87;57<35:12:019206206215215223223223223/23),- !#!(&+)+) -,!.-!.-$10'35*6838A?DMSUaegsou{æǨɪˬͫϭѭѮҰӰӴӵԵԶո׸׸ٷظٸٷַָ׺أĉy|xnf]xLiu9Vb>_l@an;bq=ds::98<87;57<2490190193092/8413413422422222222-23&+,"" " )&,)-.././01 12"34'26*5946B<>JPLYa]jlnxwy}§ĦũȪɫʭίЯбұҲӴӵԶշָٸٷعڹ۸ڷٷٺכŇ{xoh~`vQiv>Vc@]iA^j?`m@anAboAboCaoDbpFbpFbpKguNjxVp})CP   ""##"!#"# 4[m>[m9^k;`m7am8bn7am6`l8_n:apBbrDdtKiy*HX'2! !  #"$#)9X]TsxUwXz^{_|[|\}Z}\^^`~^|emfcdddcba~b|b|b|b|a{`z`z_y[xYvVuUtRsRsNo|KlyFew,K]2D.K]MgtVp}bxh~h|klmpqtuuvvwxxxy{{||}|}|zz||||~~~~~~~~}}~}}}}}|{|{{z{{z{{zyyyyxxxxxwxwvvvvvvvvuuuuuuutuuuuvuvusssstsrsrrttttttrrrrrrrrtttttttuttsssrrrtuuussqqqqpqsrrrrrrsrsssutvwwwrsstvvvvvwvvvvwwwwvwxwwwyyyzxxyyyzyyxxxxyy{|z{||}~"$$2!%>78:34051051+40+40(31(31(14)25)33*44,53&$ #%)#/!)+&/.)2'(6%&4(0=-5B+8<1>B5BH3@F,4A$1)%!#(=>FST\^clhmvht|lxfxXjz?Vl2I_!62?29B29B5;H17D&-=&-=*2?)1>+5D/9H1J5BNBLTT^flt|{~|åīɭ˭̮̯ͭαгҲѲѴӵԸ׷ֹععڸٺ۾ܪϛ{zo`|[yWu}Kkt;[d;[k;[k6^j7_k8`l7_k9^k8]j:\l;]m>_l?`m@cp5Xe5?  #"  &2AG@_kSr~Rt}Uw\y\y[y\z\{\{_|_|`{`{dnieddcbca~`}`}`}_|a{`z^{^{ZyYxVwTuStStPq}Op|Imx>bm)Q]#KW+P_1VeJhxUs]uaygyj|m~nrruvvxxxyyz{||~~~||zz||~~~~~~~}}}}~||}}|{|{zzzzzzzyyyxxxxxxxxwvvvvvvvvvuuuutttuvvvvuussssssssttttvvvvttrrrrrrttttttvvtttttttttttuuuutrsssttttttttttrssrsrtttursssuuvuuvvvuvvvtttuwwwwyywxxxyy{{|{zzxxyy{{|}{|~~~'4$&:*,5./5.//0-./,,,,,,,,+/-,0,.2-/3"/.%$    "!'!&+'-1-342897=6B-5<)18,)2'$-"!"!#//0ECIYW]^enahqSbu&5H* -(7)5D'9C%7A'4@0=I7BM*5'#-:58F+.<)#(>3::/65.52+21+00*/0*/0*/0*/0*/.+-.+-++,''(!"##" &(3$2#3*:!16)54'3'#0*&3*'!*5#.%2",9)8+   #*-DGU`cqkrt{vzz|¥ĦŪʫ˭̯ΰϱаѲӰӯұԳֵֵָ׸׷عڻޡɄ}wm_|VvUu~Kmv=_h:]j9\i6^j6^j4^j4^j5_k4^j3\k4]l4]l5^m1^i6cn)PX ( /2GY\HgsPo{Rq}VuXuYvZv[wZw[x\y[xYt~`{jngedccbba~`}`}`}_|_|^{\{\{ZyYxYwWuTuTuQuOs~Hq{Gpz?lw6cnG[8L$G[AdxUmzYq~ctgxkxn{rq~pqsuvwwwxxyz{|}}~~~~~~~}}}}}}}~~}}~~}}|}}}|||||{|{xxxyxwyyxxxxxxxxwwvvvvvvvvuusrrrssvuvvvurrrrrrrrrrttssssttqqqqqqqqqqstvvwwwxttttttttttttttttttttttttttvvvvrrrrttttppqqqpsrtuwwwwuutttuuuuuuuwwxyyy{{{{||zzyyyyzz{{}~~%%+!+-&/-&/)(,%$(%*#((/+2'&3)(5,+%$     "(&(-+-2+48/8<1<@3>B3@D1>B/<@%26&.5#+2%!.( ##&&$*+)/&,1 &+#*-6=@KSZJRY;GV4@O7AN9CP>FS?GT?IQ@JRFPWEOV-9;  !!"' );5B3-:1.7/,5-,0,+/+*.)(,+)/+)/,+/,+/)-,"&%!+'"1')5-/;-2;16?17C39E7@K8AL5CK7EM5CM/=G+5B'4'/<=ERCKREMTIQ^W_lanzlymprx£ŤƧɩ˫ͭϭϯѰұӱձճִ״մննչܿڣ̓y~|zpdLxIu|;ju(Wb-Zj/\l3\k5^m5_k5_k5_k4^j3\k3\k1]k1]k0_j1`k0]gIS:D#- 0*8KE>\]LjkHiuKlxLo|OrPsQtSsSsRsNo|Pq~KlyEfsZ{cddbdccbba~a~a~`}`}_|_|^{^{]z\y[wZvYvYvTvSu~Qs|NpyLqyJow?dq2Wd#CS8H5PZHcmWlsZovcr~gvhzhzh|h|i|k~pqrrqrrtvwwxzz{|}~~~~~~~~~}}}}}}}|||||~~||yyyyyyyxxxwwwwxxxxxxxxwwwvtttsssssutstsssststsrrrrrrrrqqrqqqqqqqqpppppqqqqppqqqpqqqrrrpppppprrrrrrrrrrrrrrrrtstsssqrrrrrtusrrrrssstuwwvvvvvwwwuuuuwwvvvvvwyyyzxxvwwwxyyz}~||~#)-!$."%*!%('*1*#$-&'(&!     #"'''---21576:5:=79EM=MW>NX:GS;HTAKS@JR@JRAKSBNVAMU?KM+79 "&*.!3"&:)-5)35)3.*0+'-)")(!(,!(/$+.(-0*/&+.$'  ! $'&*)-,.211675:;9=B<@E9CKD18A"*AGSDSYAPV7JQ;NUCXaVkt^tcyinw~£ģĥƧɩ˪̫ͰбѰҲԳմֵ׵׶طٺټۿڠɎ~xwmgL@s&fuO^@P FV%P`)Td-Yg,Xf*Xf*Xf)We(Vd(Vd)We,]h,]h)Yb!QZ-RZ(MU,JR-KS/RY?bi@go=dl?epBhsIjwIjwMkyMkyNlzMkyOp|Op|GpzGpzGq}V_]bbbacbba~b}b}b}b}^{_|\|\|[{ZzYxYxXwWvTuTuRt}Pr{Lp{Lp{Hp|Ckw5`pHX;GEQ?[cJfn[jv`o{as~btcwfzlymzq|r}q~rrsstuvwx{||}~~~~~~~~~~~~~~~}}}|||||}}|{yyyxyyxxwwwvyxxxxxxxxxwwvvtttsuututtstssssssssrrrrrrtssrrrsspqqppppppppqqpoppqqpqqqqqqopnnpprrrrstrrrrrrqrqqsttsssqrqqttvwttrrrsssuuwwxxvvvwuuuuuuwwwxvvwwwwzzzzxxwwxyyz}~~~%%!!!$$$&"    ""&%'+*...22246:359256.12*,0&(, "'!""#++,*376?C=MP?OR;LR;LR=KUB8AE9CK:DL9FL7DJ4>E0:A,4;%#*@FMCPTFSWHX[K[^HX[M]`PblXjt^r}fzltģĥƦȩ˪ˬͯαвѵԷֶշָ׷Լۛ~{{{xibFx4fuEX3F 9M=QDVCUEVEV @S:M 7M ;QJ\M_IRCL(V]0^e9]h8\g6]l9`o3^n+Vf)Vf0]m5`p7br=fv;dtEjwJo|V{Y~\_^]^^ccddcbba~b}b}b}a|_|_|^{^{^{]z\yZwZwZwYvYvXuTq{Sp|Sp|Mq|Mq|Gmx>do,Q`7F:H/KYM_jTfqWkv[oz[q|^tcufxlymzl{m|l~mmnpqstwxxxy{y{}~~~~~~~~~~~~~~}}}||{{{{{{{{{xxvwvvxwyxyxzzxxxxxxwwuuttttssutttttsssrrspqpppprqrqqppprsqqpppooopprrppnnllmmnnnnmmkkkkrrrrttssqrrrqrrqqqsssruussssttttttrrrrrruvwwwxxxyyxywwwwwvvuvvvvwwyzyzxxxyzz{|~~~~   ""   !$$%(&,,*0/+1.*0-)/,(.&%)#"& !034:CGGPT?MU=KS;IQ;IQ;IS;IS;IS:HR@MQBOS6?B%.1 !'&.'!0)$3,-&!!)"$/$*/$*)!&"% "*%'(() !   $##)(!.,'42+87/<;3>B7BF9DH;FJ9CJ4>E2)25!$&(9EG=NOCTUCXZF[]I]bK_dJ\fOakTfp[mwctzm~zãĤŦȩ˫̬ͭάͭαҵԵԸս۱Ι}||{yxwvtunobWVP}NwIr|Jp{HnyDivChu>duYcIblMfpTjuXny]q|`tetfuixixfzh|i}j~m~nnomopptuvvy{~~~~~~~~~~~~~}}}|}|||||||}|{{{z{{{{{zxxvvvvwwyyxxxxxxxxxwwwwwttsssruttsssssutrrrrrrrrqqqpppppooqqrqqrqpqqqqopnnmnnnppnnkljjooooqqqpsrqpqqooonqprsrrrsssrsuuuurqrrrrrswvvvuvvvvuwwxxvvttuuuvuvzz{{wxxxxxyz{{}~     $!*"'+#(-"(-"(* #)"#"'-,398CJMCJM?EL?EL=CJ>DK>DK?EL>DI=CHFHLDFJ''($*)'-,#1,#1,%52/,!&!.#$/$%!!  $*$"%%&      !$%( ,,%00)55.992=<9@?<>>>>>>;=B9;@/8<*37'04$($*/>DI@MSCPVCXZDY[HY`K\cQ\gT_jXalZcnfosox|xĥħƨǪɫʭ̫̪˩ͮҵֶ׽Ҙ~}{zzzwvpru{~~ytvtrsrvwtrusmqrquqprppnnfcddcbabaa```_^]~\}\}_|_|_|_|^{^{[{ZzWyVxVwVwVwVwXtWsVrUqUr~Tq}Rr{Oox@ix=fu/YlEX9E!IU;XbB_iMcnRhsXlwZnyWr|Yt~]v]vewgym{m{n|p~p}q~ppqquxxx|}~~~~~~}~~}}|}|{{{||||||{yyyyyy{{zzxxwvvvwwwwyxxxxxxxxxwwwwvuuututttsssssutttrrrrrqqqqppppoonrsqqpoonqppqqqooooonoommmmnmrrrrtuuusrpppppqpqpprrssrrrrrsttttqqqqrrttvvvvvxuuuuvuvvuvsstuuuwxzzzzwxxxxxxy{|        #!$$$$"  *0/:EC8CA6@@7AA7=I6LVCQ[CV]DW^DXcEYdI]hL`kQcnUgr_juep{kvzwåĦŨȪʩ˫ͬήаҲԵֻܲգƙȗƎ}|{yxvvuttrrrrspqqpvxspoqoouuvupqpnlomkmihgeeeeeddcbbaaa`bbba`_~]~\}^}]|_|_|^{^{[{ZzWyWyWxVwZwYvXuXuWtVsWr|Wr|Vq{UpzOoxLluGjw<_l)K[:J%AO4P^ATbH[iO`nRcqTeyWh|Zl~]o`taubudwhyhygzh{g}g}fgjlqsuvwyyz~|||{{{~}||||{{{{yzzyyy|{{{z{{{zzzzxyyxwwwwwvvvvvvvwwwwwwuuutuuutssrrttttrrrrrrqqqqqpnnnlllnoooppnnnnnnnoonnnonooononqrrqooppqprrpoppmnnnnnqprqstrqrsrqpoppssttrrrrrrrssssstttttssstuuvwwwwyxwwxxxxvvvvy{      #%## )425@>2CB0A@/?B/?B3=D3=D5>B6?C7AA;EE;EE1;; &"$/-&1/"2/$41$41#30!.-#"##!"!&$$)''-++0..5/46057-76,63.74/8-/3+-1#,/(+ (/>FMCLWENYFT\GU]EWbFXcI[fM_jRcjUfm\iobougs{q}xħƨȪʪ˫̮ϯбҲӷ߮ѐu~|{{yxvutsutstrrsrssponmlkkkjkkihhgghihhhggggggffeedccccedddcc^]~]~\}^}^}]|\{^{^{]z\yZyYxYyYyYyXxYvXuWtVsWq~Wq~Ur~Tq}No{LmyKlxHiu?`m,MZ!>P"?Q3JY>UdHYgK\jPaoRcqWitZlw\ny_q|as~btcudvgygyfzfzg{h|j~kprrtuvvw{~||zzzy{{}|||||{{|{yzzy{{{{}|||zzzzzzzzzzyyyxvvvvvuuvxwwwwwvuuuuuutsssssrrrrrqqqrrqqpmnmmllnnpprrqqmmmmnnnnnmpoppnnnnnnsrrrpqqqqqrrpoooppoooqsrsttsssssrqooppssuuttrrrrssssssssuuuuuuvwwvutuvyyyyxxxxvvvv{}          "#!#! 4DA8HE-A>-A>/?B/?B1>B1>B3>B4?C6?B9BE1<:  #!+)1.!30$41%52'43%21,2 &  !%%%''',,,...//0001.,2-+10+40+4)+0)+0$*/!', $)AEJCMUEOWDRZGU]GU_IWaJYeL[gQ_iUcm]gobltjt|q{xīƫȭʫ̬ͱбжӸվ̖}||zzyvuttsstsstvuvurrpoonnnnmmllkjjllllkkhgghggggdbbbdddddccba~`}_|`}`}_|_|_|^{^{]z\y\y\y\y[xZwYvXuXuYsYsZqYpYpYpSo}Rn|GlyDiv9gu6dr&Qa 7G&AR3N_AR`DUcIXdL[gTamXeqXgs\kwZny[oz^s|_t}bt~cuiwjxixjykzkzm|o~rstvxx|~~~~~~{|zy{{}}||||||{{{{{zz{||||zzyyyy||||yyyyxxvvvvvuxwwvwvxxxwxwvvvursrrrrrrqqqqqqqqrqoolllklkooqpqqmmllmlmnnmnnoolmlmmmqqoooooqssststqqqqqqppppttttqpqqqqrqqrtttuqpqqrrrrrrrstuwwwwvuuuvvxxyyyyzzz{zyxxxyz{}~~   !##!! (&3<:,>;/A>.?@.?@1>B1>B3>B3>B5>A8AD;CC5==  ("#0''4+)50)50*53*53,53+42*/0 %& # "%%%))))-,,0/,0/+/..-1-,0-,0,+/,+/+*.%*-$),&,1>DI@MQERVES[GU]FUaHWcHZeJ\gM_jPbmWdp_lxhs~ozv{©ĬʭˮΰабѶ־޻ڮ͙~~{zutsrrrtsssuutuwvttqpppppoomkjjjjjjjjiihgfgfggfeeddcdffdb__^~]}]|\{_|_|_|^{^{^{]z\y\y\y[x[x]x\wZtZtZtZtXrXrXrXrTq}Ro{No{LmyDjuBhs;bq,Sb#EV=N2L_6Pc@RbCUeGYiJ\lM`nResThsVjuYk{Zl|_o_ocqdrcuewgyhzfzg{i|j}klnotv{~~~~~~~~||{{{{|}|||||{{{{{zz|||{yzzzyyzzyzzzxxyyxxxxxxwwwwvvvwvututtttvurrrrrrrrqrqqpprsttqqnmmmmmnnonnommmlmmmmooqqqqmmmlmmmmmmmmtutursttttuutststtvvvvssqqqqqqooooqpqqqrqrrrrrrrtttttuuuuvuuvvxxyy{{yzxyzzyzz{}~!%!!  (548ED1@?0?>0>@0>@2>@3?A3>B3>B5>B5>B6?C-6:$&&(2,$93(<4';3+86+86*76+87'89&78)8>!06 "%!%'")+&(/+*1-,0/,0/,0/+/.*.-)-,',/&+.#*-#*-)03>EH@MQCPTETZGV\HV`KYcI[eK]gPahRcj\fmakrlryu{y~«īȭʭʰͮϯЮԬң̓~~~~}{|yxtssrrrtsutuutttttsrrqqrqqqnmjjjjjjjjijhggghihhedbacdfeca~a~`}_|^{^{^{^{^{^{^{^{^{]z]zZzZzZzYyYyXxWvWvVuUtWtWtWt~Vs}Qr~Pq}Lp{KozJnyGkvDiv>3?A3?A/<@,9=+8>&39"34"348/ ;2$85$85)79)79,7;+6:+6:*59+6:!,0!!    !""&%(,+&/-)20*/0)./+./*-.&..%--#++#++"),"),!*.;DHB,7;-8/;=-9;-8<.9=-9A/;C,;A(7=&5;$39$39'6<"78$9:$69#58%4:'6<-7>*4;*59'26&/2'*  ### )'%.,%0.&1/).1).1+-1*,0%--$,,!*-!*-!*-(+*,9EG:LO?QT?UZBX]CWbDXcE[fF\gI_jLbmUfmZkrgqxpzv{z~ìůȱʯʲͺճΠ~|{zz{{zzxwuttutttsutttrrponmklmmmmmmmlkjjjjjjjhghhhggffffebb_^^^]~]~_~^}]}]}\|\|Y{Y{YzYzYzZ{[z[zZyYxYxYxXwXwXwXwWvVuXuWtWtWtWtVsUr~Tq}Sp|Ro{OnzNmyJkwHiu?fn9`h)R\CM;I*HV9LZ;N\@Q_BSaEVdGXfIZhL]kObpPcqSftTguViwXkyZm{[n|ao~cqbtcudvgyhzhzk}l~o~qsw~~~~~~~}{{zz{|||||{|{|zzyz{{{{{{yyyyyxxxxxxxxxxxvvvvuuutvvtsqqonnnqqqqsrrrrrrqssssnnnnnnnmmlmlllllllllllllnnlmmnnljkklllllklllllnoooooopppturrppqrsrrrqpppqqooooooopppnnnpppnpopqqututtuvvuvvvvvvvvwvvwxxxyzz{|}   ,+(4-'4-'7.(:1+71)71)7/,7/,70170152.52.33.00+23067434156334123002-02-8744306203/--*&'$     "$&(#+-()0,)0,+./,/0*/2).1#,0"+/!*.!*. ), ),#).>DI?LRCPVDVYEWZCX_EZaG[fI]hJ_fMbiWfl]lriqxqyv~}}«Įɯʲ͵зԫȏ~~}|{z{zxxxwvwuuutuuttrrpppolkkkmmoonollkkjjjjjjjihhgfffffeedc`_~_~_~_~^}^}]|_|^{^{^{YzYzYzYzYzYz[z[zYxYxYxYxVwVwVwVwUvTuVuVuWsXtWtVsUr~Tq}Ro{Ro{No{MnzHnyEkv=ju8ep2]m%P`:J?7DB=JH?KMKJ>JL=IK=JI?LK@LN@LN?JN;FJ:EI9DH;DG=FIC?5:6=?::<7043.211:8)20,21-32-32,21-64+42.21043444222000---./,/0-/0-230/0-,-*333222%$(!!"!"""####"$$#'+$&2+-0/3104+03).1$-1#,0"+/!*. )- )-%+2=CJ?JUCNYDT^EU_IVbJWcMZfN[gO_iQakUfmZkrbpzkytx~îůȴ͵Эȍ}xwwwvvutssrssssrqprrppppponmmmmmnoonlkkjjjjjjjgfdcbbfefddda_}^|\z]{\z\z\z^z]y]y]y\x\xZxZxXyYzYzYzYzYzYwYwYwXvVwVwVwVwVwVwXuXuXuXuVuUtTsRq}Rq}Qp|Qo}Qo}Pn|Om{MkyJhvEeuBbr=\n+J\ Q_BSaDUcHWcJYeN[gQ^jTamVcoXdsZfu[ht]jv[mx\ny^p{`r}btcugvhwixjym|pv}~~|||{{{}}|||||{{{zyzy|{yyyxxxxxxxxxxxxxxxxxxxxxvvtssssrttssqqppqpqqsssrppmmmmlmnnnnqrssrrsrf^wZt]wdycxhyhycweyh}h}ki~fxdvi{l~qqasWi{Pbr`rjykzssj|fx_rbug{lj}gzgygygydvduevgyewfuhwjyjyhwgvgvfuhwjyhzewcv_rUmzVn{\u`ydzdzaw`vdzcy_v[rYsZt\r}TjuRhsWmxVjuZnydu{l}trl|jzf{f{hzgylzlzpzq{p}o|p}p}q}r~qrrrrsttvwxxyz{}~~~}~~hn{SYf6PP2LL.OG-NF4JH6LJ;KN=MP>QRCVW;UU;UU:SUFM?MWAOYBT^CU_JWcJWcMZfN[gQ_iSakVdl[iqcqykyt~y}įưɸѱʟ}{vvvvvvutsrssstsrqppppppppplllkllmmlllkkjjjjjhgedccbbccccbb][~Y|Y|X{X{Z{Z{\z[y\x[wZv[wWxXyXyYzYzYzXyWxYwXvWuXvVwVwVwVwWxVwWvWvXuXuXuXuVrUqRp~Rp~Qo}Qo}Pn|Pn|NlzMkyJhvGesFew;Zl-I^8M%?L-GT5KV7MX;OZO'@Q)?R1GZ-BQ*?N/CN/CN9MXAU`8J\3EW8I]:K_ASeL^pFUn9Ha%4H0?S9GWN=HYBM^=M];K[8KY:M[:KY7HV7EU9GW:HXN^7GW6HX:L\6KZ3HW2HZ0FX(?N.=%5(8$3)84:?OUZ_ejcindnudnuaq{`pz]q|`tbtcuhvhvkx~kx~ny}oz~oypzn{q~p}p}rrstuvwxzzxy{}}~~~~cjsT[dARQ?PO>PM=OL@ML?LK@ML@MLBMKDOMDNNEOOBONCPODPRBNP@LN@LN@KOBMQBNPBNPAMO@LNAMOAMOCNLCNLBMKALJCMMEOOCMMDNNEOOEOODNNCMMGNQIPSGQQFPPEOODNNCNLDOMDLLFNNFLKFLKKONLPOOOONNNGLHGLHCQFDRGDQHCPGEKJCIHGGH@@A000>>?XXY[_^Y]\TXWUYXUZ[W\]Z_`PUVHLKLPOJMEJMEQSNRTOQUTSWVSWVQUTRVUPTSPUQNSORRRPPPMMMMMMMMMGGG999BBBMMNKKLKKKGGGDEBEFC977DBBFEBGFC@GC-40'0.1:8@B=>@;===;;;-:8*75&?.&?.#7-#7-2(&:0;F=8C:9:7>?<@@@AAADDE@@A@@A??@"'#$!.)+///111+03).1#,0!*.!)0!)0!*.'+'+;HL9LS?RYAV]BW^GWaIYcKZfL[gN]iRamVco[htbo{lyp}ux~ı̲ϭʗ~~~}}wvvvvvssutssrstttrrpppnnllponnkllkkkmmlkkjlljjjjgfcabaaaa`bb_^[Z~Y}X|X|X|Z{YzZyZyWxWxUxUxUxVyWzWzXyXyWxWxVwVwVwVwUvUvVwVwWvWvVvVvVvVvStQr~Qr~Pq}Op|No{No{No{Mn{KlyIjwHivEfsDer5Tf%DV!>P&CU-GU/IW6KZ8M\;M]Ta=V`?XbEXfGZhK[kN^nN`pPbrPfsRhuSivVlyVoyVoyUr|Vs}Wt~Xu^wazfzdxpw~~~~}}}|}}||{~}{zzzzyyyxyyyyxxxxxxxwxwwuutuuuuuwxwwwwvvvvvvvvssqpqqqprrrrpppoooqpppsstvzzm~ZkyFUi!5) &  )))@FENTSO]_SacQfgVklXmnYno^msapvbpxcqyes}ft~es}ft~du{fw}g{g{hzhzi{j|k}mllnopqtu{~~ckxT\iDTWAQT@QR?PQBNPAMOCMMBLLBMKBMKENLFOMEPNEPNDNNDNNEMMCKKCKKDLLCMMCMMAJMAJMAJM@ILAKKAKKAMHAMH@KIALJ@KI@KIBILCJMBILAHKAHKBILCJMCJMBILAHKBHMAGLBHMAGLDFKCEJGFJGFJHGKHGKCHIBGHAGFAGFEEEDDDA?E>HHAKKLQRNSTLTT7??1A>AQNKTRIRPOOPKKL=LK:IH2KG4MI2IE3JF5HB:MGLUSIRPPPQWWXZY]ZY]MTWIPSFVSDTQ)81'2*(1//311+03).1!-/ ,.+-*, ),'*((;EELV@NX=OZ?Q\>Q_@SaESbGUdKXdMZfN[gP]iRblScmVfpXhrXhr[kuYnwZox\qz^s|bt~bt~hukxlymz|~~~~~}}}}|}}|{{{{{zzzzzyyyyyyxxxxxxwxxwwttutututwwwwvvvvvvvvuvssrrqqsrrrrrrrqqqqppppssvx~ygtFS_)3;  )1!#*)'''000;CCHPPGV\M\bQadTdgWgjZjmahqcjsemtfnucpvdqwasvbtw^vv`xxewzfx{lymzl{m|n~oqrstvxz|~dguWZhGUWESUERQDQPEOODNNENLDMKCLJDMKBLLDNNEPNEPNFOMENLDMKDMKDMKENLCNLCNLBLLBLLAJMAJMAKKAKKALJ@KI@KIALJCLJBKIBJJBJJ?HK>GJ?HK?HK?HK?HK?HK?HK?GN>FM?GN>FMEH>EH@GJ@GJ@GJ@GJ?GG=EE?DE'/6%)    =>F|zMKb#-=8GC9C@6@D8BC7AF8@F8@G7?G7?F6>G7?F9?F9?C9@:??:7>@9@>:@>:@;8A96?86<64:*') $!-(*0-/302-/3+-1#,/"+. ), ), **&&#&NQCSVEWZFX[IW_KYaMZfO\hP^hTblXcn]hsgp{oxt}y}ë­ĥ}}{yvvvvvvssrqqqsstsqolljjeddbZYSP}Q~WWXVRVVSPL|L|VO{JvP|Q}MyOyQ{MzJwLzLzTV[\`_^]ZY~Y~X}W|V{X{X{WzVyQyQyQyQyUxVyVyVyXyXyWxWxYwXvYuYuWuXvUvUvUvTuTuTuTuStUtSr~RsPq}Pq}Op|NpyMoxKlxJkwGkvFjuChuAfs:bn5]i1Od=R'=P+AT2ES4GU8IW:KY8N[9O\6P^8R`E?GNFORKTWNX_T^eTblWeo[go\hp`jqcmt`ps`ps^qr`stdsyetzgu}hv~hyizj|j|n|o}qrsuxy}~bfrUYeHVXFTVEQSDPRCLP@IMBHMBHMCJMDKNBMKDOMEPNDOMDMKBKIBILBILAJMCLOCMMCMMBLLBLL@IL@IL>GJ?HK?IIAKKALJALJBKICLJBJJBJJ>HH=GG=GG>HH>HH?II>GJ>GJGE@IG@GJ?FI>EH?FIA/8;(14'%    79=|}OP^%#)86<;4;:3:<5<;4;<3:<3:=29=29>2<=1;=5:<49;38=5::3::3::3::3::49:49;4;<5<<5><5>85>96?57<57<75;75;94=:5>:4?:4?75;75;84:73992;92;63<74=86<64:64:53963763763763752641570981::/=:/=9-=:.>9/?9/?4/>3.=2.;.*7%#)"#%+'-0,23/5104.-1*,0')-"**#++ +)'%'+NXBR\CW\DX]HY`J[bM[eO]gP^hTblWeo[iseqymys}w|«ĥ~}}|||zzxwwvvvvvtsrqqqrsspga]^[^`gijjmpow}{wtqrid]VNNC|B{@vBxN~M}O|TYWWV~U}T|T}T}TzSyUyUyVzUyUyVzVyVyWxXy[xZwYvYvVwVwVwTuTuStTuTuTuTuUu~Tt}Rt}Pr{Ns{MrzNpyMoxMmvLluLkwKjvFivDgtAdq=`m5Xe,O\=K >L,CR.ET5HV6IW6LY8N[7N]8O^:Q`;Ra>Sb?TcAScBTdEXfH[iJ]kL_mN`pPbrPetQfuSivUkxYmxZny^o}arbsevhwpz~~~~}~}}}}|||zywvvvvvvvuuwvxxxxxxxxwwwwwwwvvvwvvwvwvvtsqqrrqqssssrrqqqqqprrrrqqqpppppqprv~h{4AG  !"# !    ! ! "! #"  !" " " " " "!! "!"!"!"!!#!#"!$ #" " ""!#"#""!!!  #!$!$!$"%"%!$"%!"!"!"!"!""#""##" " " #!#!" !!!! # #!$!$"! $#######$ $ $ $ $"$"#"#" $#!%$ &% &%".0'35,4;19@:>C<@E@IMGPTKVZP[_Ta`Wdc[gi^jlZjm]mp\nq]or`ouapvcqyes{ft|gu}ix~jykylzn|p~qrvzz~bjwRZgGWZDTWDQUCPTCIP:@G@=GFCMIHLKJNCNLEPNCPNANLBILML=LK=IK9EG>AI?BJBGJDILALJALJALJALJCKK?GGAED@DCDFAFHCCIHCIH>GJ=FI=FI=FI;EE;EE:DD;EEFF>FFCEIBDHDFJ@BF@@@???7??6>>,:<%35%)      8:>y}IMY#(+38;77888988988976:437637526716716924924716716326437/45.34034034445556859748667667/54.433333335337556376373263263263262152152223333342232232232232235024/15115116/07015025023023022231120/3/.2+-1(*.!#' %!!-))2-/502001../'-,&,+!,* +) **''%,:DK>KWCP\EV]FW^JX`M[cM[cN\dQ_gSaiXdl]iqfsymzs}w|~~}{{{{{zvusrrrrrtrrqrpllbYUR\ahlt|ĖÙśǡɢʡǤʢ̢̤ΥϧӧӦҥѥϞșŘĖ•ykgZSD~EB{=vDxI}KyO}SR~Q~Q~R|R|RzRzUxUxUyUyUyVzUyVzXyXyWxVwVwUvVwVwUvTuStTuTuStVuVuUu~Uu~Ot|Ot|Js}Js}MrzLqyLmzJkxJjzJjzFivEhu?gs;co1\l*UeI]CW'AT)CV5GR7IT8JU9KV:NY;OZR]>Q_?R`@SaATbFUaHWcMZfMZfO[jR^mRamSbnRfqThsZiu[jv`myanzcp|er~fsjwp~|~~~~~}}~~~|}|||{zywvvvxxxxwwvvvvvvvvxwxwwwwvvvvvvvtuuutttsssttsssstsrrqqqppprrrqqqopppppppqt|[jv!*#" #" " "!#!!!!!!""" " #""!!# """"# !!"!"!! ! ! ! "# # # !# "# $ # ##"$#$#"!! #"$ ##""!#!$"#!$"#!#!#!"  # #!#"$!#"$!""# $# $#$ $ $$%#%#%#%#%#&$&$&$!($%,(2+,701>25C7:8:?;=BAJNGPTHVXN\^MbdOdfSfgUhi\kj\kjcipflshnshnsfpwhryhvxiwyjxzky{mzo|n}psvz|lv~ZdlIXWGVUFUTCRQ6CI,9?3;H9ANAIPBJQDNNEOOEPNALJ?'5=*8@8DL=IQ?LJ?LJALJALJ@GJ9@C98<<;?CCDFFGDJIDJI>IG>IG;HF9FD-8< +/28E8>K=CH=CH?DG?DGACGACG@>D64:6/8@9B>=A=<@389+01$#   :<@||CCM$!#:7985996:46:57;176/54.34-23-23.34034145034145-55-55+64+64*53*53.34056445556265154043043-32-32,53,53,36,36/47058.43.43+42+42)42)42)33)33+33+33-32,21,0/,0////000///111/32.21-32,21,21*0/*/2).1',/$),"#""#**+,/0/23+10)/.%.,#,*"-+ +) ),(+'-8EK9KV@R]CV]DW^GVbIXdMZfMZfN]iQ`lTcoYhtaoykyt~x}~}}{{zyvuttttttsqllcadiqvşɠʤΥҥҟЛ̜̗Ǔđznkikqy”ŗȚ˜̞̟͞ɜƚĕ~lbK{AqBs>o9kzBtP|Q}X|VzWxXyXyWxSySyRzRzSxSxWxWxUwVxUvVwUvTuTuStRsStUtVuUtTsNtMs~Ms~Lr}Ns{LqyOm{NlzOkyOkyIktIktGirCenBbk=]f6Tb)GU;M#@R)ES+GU1IV2JW1LV3NX7O\7O\8O^8O^:R_;S`0>@4BD4DG:JMJL5HI-@A'??+CC6HK9KN=KM=KM@JJ@JJ@EF9>?99:99:AEDDHGAKK@JJ=IK>>===18;(/2#&    69:|}JKS,*075;73973946:359-23+01/15/15333333154154/54176.43*0/,0//32/32/32333444444555333222001223/32/32-32-32-25.3627:169,/0+.//.20/3-23-23+33+33-32-32/32,0/*.-,0/////////////000222222000-,0,+/.-1-,0)+/$&* $'##/++///222,21)/.$/-"-+!*-!*-"+/'+'.=EL>LTCQYEV]FW^IVbKXdMZfN[gQ^jS`lVdn\jtbpxiws|y}}{{z{zyyvussqqsodfbdmsÚƚ˙ʘ̖ʓɑǃ{h^URJHJLKIII4~,vqq's,x?{?{G}KH}DyJ~OW\gr~ԓ|rf]JyGvFwDuHrIsPtTxVyVySxSxSxSxUxUxUxTwTwSvTwSvSvRuStStRsStUtUtStRsPtOs~Nq~OrNq~Mp}Pn|Om{Om{MkyJkwHiuGhtEfr@cp<_l7Yi.P`!@R ?Q)CP*DQ1GT3IV4JU5KV7MX8NY7O\7O\6P^6P^9P_;Ra>Sb?TcCUeDVfFYgGZhJ]kM`nObpQdrXfuYgv[ix\jy[lz[lz\m{_p~lz|~~~~~~~~}}}}|||||{{zzzzyyyyyxxxxxxxuuuutttttsvvvvvvvvvvssooopqrqqppssutqppppppppoooonnmoooosxyJX` '%)!%%% !  "#""    !# " $# " """"" " " " "!"!"!"!" " " " "" #! !  "!#####"""$!#!'%!'!'!#!#"" #"%$"$"!" ! #!$"%"%!" !"%"%%$$#%#%#%!&"%#$"%#&$&&''&)*),-*/2/47,7;.9=0=C4AG6DN8FP>MSGV\KYaN\dP_eSbhUckXfnVipXkr^ps^psbqwdsyft|ft|iy|k{~l}~otwz}~~nw{^gkIZYDUTBSRARQ:PN8NL:MN;NO>OP>OPDMPCLOCLOCLO>KJ=JIKJ6JH4HF0HF2JH8LJ9MK?KM>JL@IL?HK?FI=DG8@@

GE@IGBJJBJJ?II>HH:IH7FE+<=+<=5AC8DF=DG=DG?DE?DE?DE;@A5:;,121677<=9>?8=>.7:%.1%%     6:9OQV,*075;548548169/47)./)./-10/32222222333444555555111(((/++400230230222333444444223++,-,00/3/23/23-23-23-25/473:=-47)(,'&*,+/0/3-10.21-32-32.43-32///+++,,,---/0-/0-///000222222000,,,-&//(1-,0-,0)+/#%) $' "0)+1//422-10,0/#--",,!*-"+."+.'*$(MSCRXEV]FW^JXbKYcM[eO]gR`hTbjWem[iqep{lwv|z~{{{{{{yxxwutsnlg]lw{ʫЧѧџҜϓ̉}ucZA8{.w+t4v7y:v>zA{C}L}PWYSPJF{Ew?q?t;p8q8q$dUq Pt QuSyY^-t9=UaxǛəǔ~r^Nw@l?kCmLvRzOwSxTyRzRzSxSxTwSvSvTwSvSvRuRuQuQuSu~Su~Su~Rt}RsQr~OrNq~OrOrQr~Op|No|No|MnzLmyImxGkvFjuEitBer@cp:\l5Wg+M]!CS!BN#DP+FP-HR3JS3JS1LV2MW4N[4N[5O\5O\8P]9Q^=S`>Ta>Sb?TcCVdEXfG[fI]hM_jPbmUbnXeqZgs[htXjuZlw\ny\ny_muq|~~~~~~~}}}||{||||{zzzyyyyyxxxxxxxxxwwvvvvvvvvvvvvuvuuussqqoponnnnnrrrrrqqpppppooqppppopppoqtuEV]#'%)!%!#!#! !  !   !!"$!#"#"#"""" " """   " " " " " """"""!! ! "! # #!!!! # # $#&&&& # # !!""!"!"!"!"!"!!!""##""!""#"%"%####$"%#%#$""#"#$$%%&&&&(&)'#,*&/-*14-4717<5;@7=B8>C?DGEJMHORLSVOUZRX]P]cTagSdjVgm[lm\mn`psaqtervgtxfwxiz{j~|l~ostvy{kr{^enJYXFUTASPASPASP@RO@QP?PO@NP?MODNNDNNCMMBLL@MK?LJ?LJANLBOM@MK@MK?LJ?LJ>KI9JI8IH8JG9KH>JL>JL>JL>JL@JJ?II>IG=HF=FD?HF@IGBKI@KI?JH?HK>GJ;HG9FE5BA5BA7DC8ED;DG;DG;EE;EE=FD9B@8>=4:98?;:A=8A?4=;287)/.%    6:9QSW778445445058-25(.-(.-+10-32-32-32.34.34034/23*((%##0+-4/1222222/32/32/23034,14&+.'+0,05-23-23-25-25-25.36248,.2'&*'&*/,02/3222222230230222111,,,(((+,)-.+/0-./,-2.-2..3/-2.--.))*'$.+(2',-',-"-+)'!"&&-&-/.2215,21)/.#.,!,*"+.!*-!*-&)"&:GK=NUCT[CU_EWaIWaLZdM[eO]gQ_gTbjWeo^lvfp}kut}w}~}zywxzxvtttllpt{¢ˡʣϟ˛͕LJphYLIINUhm|~{ysoXR~>w+dzLoNqQw"Z*hA]eyjN}Fu5j0ezCpJwQyRzWxVwVwUvTwTwSvSvRvRvRvQuRsRsQr~Qr~Pq}Qr~Pq~Pq~Nq~Nq~OrMp}Nr}Lp{No{LmyImxHlwFjuEitGfrDcoB`n=[i4Ub'HU9B!CL'EM)GO-IQ/KS/JT1LV2LY3MZ3MZ5O\5O\5O\8O^:Q`;Qc;Qc=Tc=TcAVeCXgEZiF[jL^nN`pPbrQcsTfvTfvXjzZl|]lxcr~t}~~}}}~||{zzzzyzyyyyxzyyxxyyxxxxxxxxwutttstvvuvssqqqqqqpqononnnnnnnppppqppppppoooqqppppppootzvFT\$+(%%"$!$!# "  !  !!"""%!$!# "! ! ! !  #"  ""####!"!!""  """"!!!#!# "!# $# $!%!$!$""""#!#!#!" " #!#!#!$"#!"!#"#"#"####$"%# $# $###$$$%!%$"&%'"'"'"(#(& +)#+2&.5(2:-7?,:B.F4BJ:DK>HOAKSEOWIS`KUbM\bQ`fRciVgmXip\mt`nxaoy`uwbwyez|h}i~lmortflxZ`lGXYARSASP@ROBROAQNCPNBOMBNPAMOCLPDMQDMPCLOCMMCMMBMKCNLCOJCOJBNIAMH?LJ>KIJL?IIAKK>KJ>KJ=JI>KJALJ@KI@KI>IG>HH=GG:FH9EG8DF8DF8CG9DH8CG8CG;DG;DG9CC6@@7>A6=@7>A8?B5>A4=@*68".0$&      598NST"058/47/47.34,12(22'11'20)42-32.43215215215104*)--,00/30/3223223222222/32/32,05*.3(.5*07-25-25-23-23/23/23.12+./)+/)+/-,00/300011123023023001.(.-'-,%.*'0,*1-)0,/0-/0-02-.0+,-*+,)$),',/$-0#,/",,((#&!#$(!#0)+2..622-01+./%--#++!,* +) +))'#.,@KIBRUDTWCXZEZ\JX`M[cN\fO]gRagTci\fm`jqfpwoyu{z~|{yywxwurqpqqrŦӥҢџΈ{sqf_^_dfw}ţĦǦȣŤŤŦǧȪ˨ɦɫΥƦǦɥȨˡģħȤŦǩʢÛbLw.d}(^w \}%a&h-oGRlvskZNyDpAmEqEqOuPvSvTwSvSvSvRuRtRtRuQtQr~Qr~Sr~Rq}SqRp~Pq}Pq}Op|Pq}Pq}Pq}OqzNpyMn{Mn{IlyGjwFivEhuDgtBerBcp>_l:[h-N[?L AN'EM'EM0IM2KO5JS6KT6JU7KV6LW7MX6OY6OY9O\9O\:P];Q^>Q_?R`CU`CU`FXcGYdKZfN]iQ`lRamUbnXeqXgsZiu]ku]kufrzt~}~~}}||||{|||{zyyyxyyyxxxxxxxxwwvtttsttssuussssssrssrppnnnnmnnnppqrqpppppppqqqppppooooopxwER^"-%)!%"#"#!#!  !!! !   # #$$## " " " "   !  !!"     !!! !  " " !!"""" # #""!!""""!!!" " $""!"!"!"!"!"!"%#&$##"$ %!!%$!%$!%$"&%&$&$&"'#!%$"&%)&*,)-/,04151545982;95><;A@>DCBDHFHLIKOLNRNSVQVYPY]U^bYah]el_kmbnpbqpetskwymy{o{}p|~prsu_gtT\iFWXBST@RO?QNBOMANLDLLEMMEMMFNNCMMDNNCLOCLOCMMBLLBLLCMMCNLCNLBMKALJ@KI@KI=JHGJ?HKAHKBILAKK@JJ@KI@KIALJ@KIAJH@IG>GJA7>A7>A4=@3=1@?5?F9CJ=EL?GNALPEPTHRYLV]PZbQ[cXcg\gk[lm^opervgtxgv|jyk|npqagtY_lGXYBSTCRQAPODNN@JJAHKBILDKNELODNNCMMCMMCMMAKKAKK@IM@IMAJNBKOBLLAKK@JJ?IIHH=GG@GJBIL@IL@IL?II?II@KI@KI>IG>IG=FI=FI=FJ=FJ=FJ;DH:CG9BF9BF:CG;DH;DH:CG9BF8AD6?B8?B8?B7??4<<,75#.,#!     444vx|NPT%--/77+64+64-64.75.43/54154154034/23-25-25.43-32/32/32223223223223/32/32.34.34.36.36-25-25-32-32,21,21+10+10+10+10-10-10//0//0//0001001001.21/32+10*0/&..'//'.1'.1*-.+./*.-*.-+0,*/+(.-(.-%--$,,#++ (($# %!!-))0..311*0/(.-#., +) **))(+%(,.8FH8OQ=TVAW\BX]HXbJZdM[eO]gQ`fTciWfl\kqeqylxs|x}|z{xuporʝ̛ДɃxmghlx}çƩ˨ʦʧ˦ʣǥȤǥƩʥƤţƢşšǣǣǣƢţƤǤǢŢƢơġģ££ģģĤťǣŢĢģŢОŸŝ×u_Hz?q"\uTm.fck7\d/R_"ER%CQ$BP)DN*EO0FQ2HS3IV2HU/JT0KU2MW2MW5L[6M\4N\5O]6Q[7R\7Q^9S`=/?B0@C2AG4CI8DLIG>IG;GI;GI?HL>GKACH?AF?=CB@FB@FB@F>BG>BG9BF8AE;BE7>A;>?;>?9>?7<=)48!,0"&      778{xPMV%'+248056056065065058058248137.34-23,53,53*53*53/47/47026026223223223223034034/47.36.34-23-32,21,21,21.21-10.21.21000000//0//0/.20/30/30/3001001,/0,/0+./+./-,0-,0.,2-+1.-1-,0,,,,,,,,---.%,/$+.!++&&!!)3()2..400*/2(-0#,/!*- ), ),(+(+%//>HHARSCTUAXZCZ\G[`I]bM\bO^dTaeVcg^gkbkohpwow~v{{~}{{zxvvs|Ş̝˛Ϊ|mefsũȬ˭̩ȣɤʢʡɡǢȧˣǣǣǣǣǣǣǣǤȡǡǡǡǢƢƤȤȤȣǤȤȢơššššţţššššŞœŸţƥȥț}aBj}RkTm"b~5u[j{i?v-dy.j~6rFvGwQvQvRuRuQtPsPsOrNq~Nq~OoNn~No|No|No|No|No|No|Lo|Lo|HmzHmzIlyHkxHivGhuCfsBer=cn7]h5Ue+K[&BP#?M*CL+DM/FO1HQ1GR3IT/IV/IV0JW1KX6LY6LY9LZ:M[;OZ;OZ:P]T_?U`CWbDXcFZeH\gJ^iL`kR`oTbqYfr\iu`oukzx~}}}}}{{yxyyyyyyxwuuutvvvvxxwxxwwvvvttqrqqssrrrrrrqqpqstqqqqqqqqqqssssppnnllllooppooookkkkq{vANT $%)"&"("(!) ('&%$!"!" !  !! #"$"#! $#!$!$"%#&"&!% $!% &%%$! ! !  "!!" ! ! ! ! !!" ! ! !!" ! !!!#$ ! !! ! "# ! ! !"!" #!$ & &"#$%#$#$#%#%#%#%$#%$&%&%%(%('&'&&(&(&)&)%(%(%)'+#).$*/&-0)03'74+;8,=>/@A/>D0?E8AE;DH@HHCKKFLQIOTOSXSW\W[`\`eVfiZjm[pr_tvaw|bx}aye}imy]amIVZFSWCRQBQP?LJ)64+477@CCLJENLENLFOMBOM@MK>KI8EC1>=8ED=IK?KM?LJ>KI@KIALJ>HH7AA,594=A;EE?II@KI@KI?II@JJ?HKHB?I>BG>BG>CF?DG=CB6<;889::;<:@;9?478*-.$     6:9|~MOT!"367/54065176176056/45034145/23/23/32043/54/54/77.66/45.34222222222333043154056.34-23-23-23,12,12,12.21/3223023013.02-//0//0001001-01.12-01-01-01,/0+./+./../../..///0../../0-/0-//,..+-,,,,,,$*) &%!  $)'-../112-10*.-%--#++!*- ),(+&)&%:GF;MPCUXBX]DZ_EZaF[bK\bM^dRagUdjWfl\kqgqyku}s|x~||xupl}ƤͧѤΖ̈́qkbmͱͯˮϮϨɥƥǥǢȣɣǣǣǣǤȤȣǤȣǣǣǣǦǥƣƣƣƣƣǢƣǣǦʥɥǥǥǣţţţţţţţţţţŢĠžž–wN6i|Yu[w7iNqsQ:h|)cu4nDwExQvPuPuOtNsNsPsOrOp}No|No|No|No|No|No|No|No|No|LmzLmzKlyJkxHivHivFgsDeqBel?bi9\c4W^$FO BK%BN&CO,EO.GQ.GQ0IS,IU-JV/IW0JX4IX5JY3I[4J\2N\3O]3O]3O]9P_:Q`;Ra;Ra;UcZhA[iB\jI]oK_qNaoResYku`r|i{~q~}~~~~~~}}}|||{{{{{xwwwwwvvvvvvxwwwvvttstttssssrrrrssrqssssrqqqqqqqtssssrppnnlllknnppqqonnnmms|p~=KS  )$'"%$($($&$&"$!#"#!"! !   !!""#""!#$#$"%"%#&#&#&$'#'#'%&$%"# # "!# "!# ""!! !"!"!"!""#!"!"!"!""#!"!" # #!$!$#!#!# # $!%"$"%#&&''''&&$)$)&)%(%(%(%(&)&'&''(&''('('(()(*(*(,'+'.'.%,%,(*(*(/(/*2*2"08%3;#8?%:A&>D'?E*AC-DF3DJ5FL7FR9HT?LXBO[GT`JWcI\cNahPelTipQkqRlrRjwPhuchqZ_hIVZERVAQT?OR;LM/@A5DCMLKI?JH?JHIG@KI?JH@IL@IL@GJ=DG777:::DBBFDDCHDBGC@FE@FEBFK?CH2/9.+5<3AA8FCE?AE@BF:DD;EE8CA)420563898:>9;?.66'//'%     376{~ORS*-.256154154287065//0//01/5206223223222333154376056.34/23/23333222222222222444154/32.21.21.21.21.21-10111222341230///---//0//0000000-10-10,12-23,12)./,,,---...///...000+10,21-32,21(.-'-,'-,'-,$)* %&! #-))2..511001--.',/%*-!*-!*-,+'&'&9FE>NQDTWBX]CY^IZaK\cL]cN_eR`hTbjZgm^kqfquny}u~z~}}}}wtrt|Ɵ˛Ǔċxtx ůγұЮ̧ͨˤȤȤȤȣǣǤȣǦȦȤȤȤȤȤȤȤȤȦȦȣǣǢǡƢŢŢţƦȥǥǥǥǣšǡǡǡǢơššţţŢğ~XHr:j6f|FwOeutfF{?t:o;pBoFsNuMtPsPsPsOrNq~Lo|Lo|Lo|Lo|Lo|No|No|No|Mn{JmzJmzIlyIlyGkvFjuDhsCgr@do>bm6_i1Zd+P]#HU&@S&@S-CN-CN1EP2FQ1GT2HU3HW3HW3HW3HW3JY4KZ1NZ2O[3P\3P\:P]:P];P_=Ra@)@B+BD3CF5EH6EK9HN=HS@KVBOUERXGV\KZ`L^iPbmNdqLboJ^pG[mXbiQ[bGXYBSTAQT@PSJL>JL>GK;DH5:=9>AAEDBFECGFAEDADEADE?BJ;>F+/;04@79C9;E@>D@>D;?D<@E7CE7CE1?A(68+9;+9;1:=/8;.66(00'%     154y|}QTU.04248043043598043')-(*./.2215215215222444555555223../../112222222422422222333043-10..///0///111000111000222556556)'-(&,0)02+22,13-2/.2/.2.04026.04)+/,,---.......+/.,0/*31+42-23)./')-')-(+,(+,$), %( #-))0..311,/0+./$/-"-+",,!++ ),%(&(=IK@NVDRZEV\GX^L[aM\bL]dN_fP`jRblXgm]lrbrujz}o}ux{}znmvЦСˑƩʫ̭ίѩ˩ͧ˦ȦȥǦȦȦȦȥǦȦȥǥǦȥǦȦȦȦȦȦȦȥǣǣǣƣƢšģĤŤƤƤƤƤƤƤȣǣţŤŤŤţģĢàžjMv"fvcs#k}4|gr}iU}Lt:h~=kJtJtOtOtPsOrNq~Nq~Ln~Ln~Ln~Km}Mm}Mm}LmzLmzJmzJmzJmzHkxGjwFivEhuDgtAdq@cp:`k6\g2S`)JW'BS&AR,BO-CP/BP1DR2ES3FT4GU4GU3IV3IV0JW0JW/LX0MY1NZ2O[9O\9O\:P];Q^=S`=S`?Ub?UbCUeEWgHXhIYiLZiO]lRamUdp_ntetzq|{~~~~~}}||}}||zzzzzyyywvttttuvvutuutttvvuuuuttttrrrrooooqqqqqqnnppqqqqnnnnppppponnmmnnnmmmmlu~lz:HP +$'#&#'$(%)$("%!$ # # $#%#!#"&"&& ")+ $'..+% #((%/(1 "+ ( !* $)%+&,&,'-'1,6-5,4 )1 )1 (2,6,6+5 (0 *2-5 (0-5-5/203 14 0318 07 /8 .7 /8 /8 29 297=:@:=9< 5; 5;8@9A8@7? 7= 7= 5; 39 19 191>3@3@2? -:*73>5@ 6@ 5?8G8G 3B7F6G5F 2C 1B,>5G#;H%=J.>H1AK2CI3DJ7EM:HP;IQ=KSDNVHRZPSaSVdRVhPTfCNg>IbYbmV_jHYZDUVARS@QR>OP>OP@PMAQN@PMAQNANMANMBONCPOBOMANL?PI?PIANL?LJ@IL?HK?HK?HK=JH;HF7JD9LF;KH
  • KJ>KJ@IL?HK>GK=FJ;EE;EE?HF@IG?HF>GE>GE=FD=CHB5>B6@@8BBC=?D:@E9?D3?A/;=.;:/<;0;9/:8/86(1/'!    -10rtxPRV/23367/32043154,0/&(,(*.-/3/15/23/23043043.34.34*/2',/*-..12222222222222222222.04*,0'+0)-2///000000000112223:9=104,"-+!,1%52&62(23)31*13,3206317(-.%*+'*+),-+/.*.-...///-01-01,-5'(0"$.#%/#*-$+.$*) &%"#*'+/+12.4-01+./%.,%.,",,!++*,(*'-;JP]i8Wc1P\)ES$@N)AN*BO/BP1DR3DR5FT3FT4GU3IV3IV/IW/IW/IW0JX4KZ6M\9O\9O\9OZ9OZ6P^7Q_9Sa;Uc>Ud>UdAVeCXgEZiF[jH^kLboVhs\nyjuq|y~~~}}||zzyxxxxyzyxyyyvvvvvuuuuutttsuuuuuuutqrmmmmmmonnoooonppppppnoonpppppponnmnmnnmmmmlmrxjy7FL !($'#&#'$(%)#'!$!$"""""&!%#"#  ''77@KCNBZC[@\@\>a>aA]A]CYAW@TAU@VAWBXBXESJXN]N]!Oc!Oc'Ui#QeNd'Wm#UkPf$TjOeRgPeLaRgOdMbQdRePeMbNcJ_MdRiRgTiPePeUjUjTd!ZjXfVd Wl"YnVkPeQfVkVkRgTfWiVkVk"TpMi Rp Rp!Ul%Yp%Zo Uj Uj Uj%Ws$Vr Up&[v"XqSl(ZvQmA] 7S6K9N#>H$?I-@G1DK4EL4EL4FP5GQ9HT=LXAL_BM`EIc?C]9;Z68WW]j[anJZ]DTW?QT=OR?PQ?PQBOMANLANMANMCLOCLOEOODNNCPNCPNAQN@PM@MK?LJ?KM?KM?II@JJ=JH=JH=JH=JH?HK?HK@IL@ILAHKAHKAHKAHK@GJ@GJAFI@EHAFI@EH>EH=DG;DH:CG7DH8EI6DF5CE:AD9@C<>B<>B9?D8>C1>B0=A->?,=>-=:.>;,8:#/1$(      043vx|PRV0/3548222222-32,21'04(15)26)26.36.36-32.43.36-25+03(-0).1+03223223223112223112,/0+./&-0(/2+10,21-01-01.12/23223../.'0-&/.'00)2.+//,0...///-10+/.(*.$&*+*.,+/---------.../.2/.2,+/('+!&'"'(%,(&-)$*) &%! (!0&)4*-7-0/.2-,0%,/%,/"+.!*-!*-&)'+?HLBOUERXHW]JY_KYaLZbM[eQ_iQbiRcjYhn]lrjrypxv~{}{}|~ɧӤЙnjʲϱαѭͦʦʦʥɥ˦̧ɧɦȦȦʦʦȦȥƦǦǦǥǥǥǥǦȦȤȤȤȣǣǣǥǤƢƢƢơšŢƢƢƤƤƢƣǢơšŢơšŢĠ  Ÿyd6p'as"dy;}^ozjBv?s9o8nGqHrNsMrIq}Iq}Gq}Fp|Go{Go{JmzJmzLmzLmzLmzKlyJkxIjwHhxGgwEdvCbt?aq<^n6[h1Vc+JV$CO+AL+AL3BN4CO5CR6DS5GR5GR2HU2HU2GV2GV1GY2HZ4J\5K]9LZ9LZ9MX:NY9OZ:P[:R_;S`=Ub=UbBUcDWeEXfFYgH\gL`kTcoXgscnyjur|{~|{|{{{zzz{zyyxxxxxxxvvsssssrttvuuuutrroommmmlmnoppppnnnnppppppppppppppmmllmmmlmmmlmltzfrz7CK '%)$($($("'"'"&"&#%#%!$!$%%&")%.!8ABV#MaRo!ZwSuRtSuTvVvRrRpXvSqNlRnPlOkWsRnOkTnUoVkTiWlUjWnTkSlUnSnSnTqRoWpZsXlVjVjVjVj Th ThWkWnVmTkWn[oXlSjSjWnYpXlXl Ui VjWkYm[qXn ToUpYoXn VjWkYr[tZwUrXuZwWtUrUrUrVqVq\yXuWt]zYvUrYwUsRs Kl C^?Z?P>O.@K/AL6BJ7CK7FL7FL;HLDI=CH:CG;DH;DH;DH;AF:@E:@E:@E:?B:?B9@C9@C6?B5>A5??3==3><2=;/99&00#&     154zOTW&&'556222111/32/32-23-23-25-25+25+25+25,36-47,36*14)03)03*14,14,14112112111222+01*/0)03)03+01,12+01,12)11*22/.2.-1.+/.+/,+/,+/(-.)./)/.*0/,0/)-,(*.)+/',-(-.(.-(.-*.-+/.../--.(*.%'+ )'"+)#-'#-'$*) &% %".&+3*16-4/-3-+1)+0(*/"+/!*. )-&*&*l6dxSb?Tc@VcBXeDZgG]jL`kQep\jtbpzlv~u|{}}}}}}}{{{zzzzzzyyxyxxxxxvusssrsrttttvuttrqmmmmllqqqqppnnllllnnnnnnmmmmmmmmmlmmmmkkkklmmmry^ou3DJ!$ %&$%#&"%"&"&!) (!%!% $ $&&!)(02?.O\$[v0g"d b_Y~Y~W|ZyVuVwZ{UvTu\}Z{VuXwUvTuTuTuTq SpVn UmUpVqTqTq Sp SpTqUrVqVq To ToUpUpXnWmVnVnTqTq To To To To ToUpVqUpVnVnWoWoWoWoVqVqWrVqWoWoWoWoUrUrUtUtVsVsUrUrUtUtUrVsWvVuTuTuTuTuVuUtYzZ{Op GhCY ?U$@N$@N3@L3@L5CK6DL4FI5GJ7EM5CK69N.1F*$G& CXad^gjM[]HVXCPTANRBMQ@KOAJMAJMBKNCLOCPOBONCPNBOMBOMANLALJALJAKKBLLBLLAKKAKK@JJDJICIHBHGBHGBGHCHICHICHIDJIDJICIHCIHBGH@EF?DG?DG?DG?DG?DG>CF7@>7@>6?=4=;097'0.#$    154x}~PUV,,-44512/12/222222/23/23-25-25-25-25-23-23-23-23+25*14*14)03+01-23/32.21.21.21.04-/3/.20/3112//0..///0//0//0.-1.-1../../--.--.-,0-,0--.--.,+/,+/,+/-,0*.-*.-(.-(.-(.-(.-,,,,,,+++)))%*&',(','','%*&"'#$!+&(2,15/40.4.,2'+0%).!*.!*. ),'*&*@IMFT^ES]EU_GWaJWcLYeN[gP]iR`jUcmXfn[iqcqyjxq}v}{vs}Ÿɡ˗ȑˆħʨ˫̫̩˩˩˨ʨʧɦʦʧ˨̧˧˧ɧɦȦȦȥǦȦȦȦȦȦȦȦȥǥǤȣǤȣǣƣƣƣƥƥƥƥƤŤŤŤŤƤƤƤƢƢơšŠĠģġ wd>o(Yl(`rH%@J+?J.BM1BP1BP4ES4ES0FQ1GR/GT0HU0GV1HW1HW1HW3KX3KX3KX4LY5L[5L[7N]8O^;P_SbATbCVdDWeGZhH[iM`nVeq\kwdpxlxu}~{|}}}}}}}}~}~{zzzzzyzzyxxxxxxxxxwuttttsssuuuutussqqonnnnnppnnnnnnnnnnkkkkmmmmkkkjnnmljjhikjjjllqzaow4BJ $$#$##$"#"'!&(((' $ $!%$( &/!:CI_5cy)j&gdb a ^ ] [~ Z| Xz Uz Ty Vv VvWxVw Tu Tu Tu TuTuTuUtUtUtUtTuTuTuTuTuTuTuUvVsUrUrUrUtUtUtUtTuTuTuTuTuTuTuStTuTuTuTuUtVuVsUrUtUtTuTuUvTuTuTuTuUvVuUtUvUvUvUv Tu TuUvUvUvVwWxWxVwVwVwUvUv TuTuUvTu RsIh Cb=P?R)?J*@K.CJ.CJ2CI3DJ6BJ3?G14I),A' G!A_hf`igM[]GUWBPX@NVBIR>ENBEFEHIGLHINJFOMFOMBPKBPKCNL@KICEJACHGFJJIMEKJEKJALJALJALJ=HFAEDAEDEEEFFFDHGFJIDJIDJICIHCIHDDDCCCBBCCCDAEDAED?DE>CD=DG=DG=DG;BE;@ABA;?>;?>;?>7>:6=9-64%.,&$     /32v{~PUX46:137230230230230/32/32-23-23,14-25-23-23-32-32-32-32+42*31*31+42.21.21.12.121041040/30/34/13.02-/1,.1+02,10-11.2/,./,.1,.1,.-,0,+/,,-,,-.+-.+----------,,,'-,(.-(.-'-,,,,,,,**+(()(((***','','#)(%$ % .)%2.,51//.2-,0&*/%).#)."(-"),!(+%(?FICNYFQ\FV`HXbLYeMZfN[gP]iT_jVal\fm`jqfpxnxs}w|}qq~ȤТΙŋ«̱үά˩ʩʩ˩˨ʨʧɦȦȦȧɨʧɦȧɦȧɦȦȦȦȦȤȤȤȤȥɣǦȥǥǧɦȦȥƦǥƥƥƤťǥǤƣţĤţĤŤŤŤƣšġĠàߞv[+g{Xl ]nA~uvZHm>g~AjKnKnMp}Lo|Lo|Lo|Lo|Kn{JmzIlyJmzIlyJkxIjwHivHivHivFgtBer@cp8`l5]i1Vc)N[&EQ#BN*@K)?J.BM/CN0EN1FO0FQ0FQ1GR1GR1GR2HS2HS3IT5HV6IW6JU7KV5KX6LY8N[9O\:O^:O^=O_?QaBSaCTbCVdEXfIZhK\jV`m\fsdmxfozoyvx}||}}}}~}}}~}}yxxxxwyzyyxxxxxxxxwwwvvvuuuuuuuuutssqppqppppnnnnnnnnnnmmmmmmmmmmmllmllkjjiiihijjlmu|ept8CG ##$"#"#"#"'"'"'"'"&!% $ $#'(,1;*GQWp4l$nged` ^ ^ \ Y W~ V} V} Xx XxXx Vv Tu Tu Tu TuTuTuTuTuStTuTuTuSwSwSwSwUvTuVwUvUvTuTuTuTuTuTuTuTuTuTuTuTuTuTuStTuTuUtUtTuTuTuTuTuTuTuTuTuTuUvVwUtVuUvUvUv Tu Tu TuTuUvUvVwVwVwWvVuUv TuUv TuVwUvVwWx Pp LlD^B\#@L$AM*BH*BH1BH1BH3?G/;C,2F$*>C?[dbajhO[]KWYGSUCOQ?LK+872=;8CAALJCNLCNLCNLANLANL?LK7DC,2>,2>>AOBESCKKCKKALJALJ?JH8CA1675:;<>BACGBGHCHIDIJDIJEIHCGF<:@539=:DA>H>CD?DE:DD:DD;EE;EE;CC7??68=9;@<>C>@EKWER^BW`DYbEYdFZeMZfO\hQ^jTamVdnZhr`mykxq|u{{s|ɣѝ͎ũ̱ԯЩʩʩʩʩʩ˩˨ʨʧɦȤȤȥɥɥɥɤȥɧɧɦȦȦȧɦȧɧɦȤȤȤȤȣǣǣǢƤƥǥǥǤƤƤƥǤţĢšĢšĢšĢšġġĠߞ|f.atNa'\qLwsJs:cz.cx9nEqEqLo|Lo|Jo|Jo|HmzGlyIlyIlyHkxGjwGjwGjwFivEhuDeqBco@am<]i7[f0T_(MU!FN AF!BG%BL'DN'DN(EO*GQ*GQ*GQ*GQ,GQ,GQ0HU0HU3IV3IV4IX4IX/LX/LX0MY1NZ6L^7M_:N`Vc@XeBZgC[hL\lRbr[ht`myht|nzr{}|}}}|}}}||{{{zzxxxxxxwvvvvvvvvvvuutvvvutsqqpprqqqsspqppnnnnnnpppppommihkjmmnolllllljkkjlkhhhhllw}`ko8CG  #$#$#$$$$#&#&"'!&"%!$"$"$ #(+0@N,Xf+k'ggghf b a ` ] ] [~ [} Y{ Xx XxUv Tu Tu TuTuTuTuTuTuStSwSwTuTuTuVwUvUvTuUvVwUvUvTuTuTuSwSwTuTuTuTuTuTuTuTuTuTuTuTuUtUtTuTuTuTuTuTuTuTuTuUvUvTuTuTuUvUvTuUvVwTuTuTuTuTuVwUvUv TuUvUvUvUvUvUvVwTuStUvQk Ic>PBT"CJ"CJ*CE)BD)>E$9@,C$;B@T][dmkP^`IWYESUBPR=KM5CE;FD?JHALJBMKBMKBMK@MKANL=KM4BD/=?6DF-0847?;@A?DE>IG?JH?JH?JHDGHADE556223;:>A@D=FD=FDJ@L$BJ'EM'DN(EO)FR)FR+ER,FS-GT,FS/GT1IV3IV3IV3IV4JW2JW2JW6IW8KY9K[:L\Pb@RdATbBUcCVdEXfJ[iPaoUgrZlw`pzfvm|sz~~||||||{{{{{zxxuuxwvvvvvvvvvvvuuuuttsssrrrrrrqqsssrpppppppprqrrrqmmkkkkmmmljjjjkkmlllkkkjhhjkubos5BF #$'#&#'#'")!(")!("&"&"(#) $*(.IY0]m+m"dgghh f d` ^ ] \ Y W~X{WzUv Tu Tu TuUvUvTuTuQwQwRxRxSyRxUvVwUvUvTuUvUvTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuUvUvUvVuUtTuTuUvUvTuUvUvUvUvVwVwVwUvUvUvUv Tu TuTuTuRt LnGeCa!CTAR)?J'=H*9E%4@&B:? =S[[emmS_aKWYESUBPR=MP;KN;LM;LMANM@MLBLLBLLCMMBLL=LK8GF5FG7HI;LM;LM@ML?LKAKKAKK?II;EE6?B:CF;FD=HF?JH?JH@JJ?II@GJ=DG06;17<7=B;AF=DGC=?D=>F=>F>@D=?C3@?)65&78(9:+9;+9;)64!.,&%      ,0/ptyOSX.05138/32/32,53+42+10)/.0-13046135027/4805739:6<.27'+0'+0*.3+03+03-/3.04215326215/.2-,0,+/2-/2-/0..1/////0000/3/.2-*.,)--',0*/0+-0+-0+-0+-+/.-10*31%.,&+,&+,,,,,,,,,,+++,,,---,,,++++(**')''(''('$(# $# !")1&'1-+51////---&*/%).#)0#)0 )-(,#)0=CJBMXFQ\FW]GX^HWcKZfL[gM\hR_kTam[em_iqfnult{szx~ytŢΡ͙ʎÞƩѵױӬΪ̪̩˩˩˩˩˨ʨʨʨʨʦȤȣǤȤȤȥɤȥɤȤȤȣǤȤȦȦȥɦʦȦȦȦȥǦȥǤƥǥǥǤƤƤƣţţĤŤŤŤƣţŤƣŢģšÞb=`tH_2]t]v{]Bl&]r5l@pAqLo|Lo|Mn{LmzLmzKlyIlyIlyGjwFivEhuEhuAiu>fr8dr5ao1\l,Wg-Ra#HW!=K#?M'?L*BO+CP+CP,DQ,DQ-ER.FS,FS-GT-GT-GT2HU3IV3IV3IV3IV4JW5JY5JY8JZ9K[;M];M]=O_?Qa@Sa@SaATbCVdKYhO]lTcoXgs]mwaq{jxo}tx~}~|||||{yyyyyxxwwwwwyxxxxxxxxxxwwwwvvusspoooooqqrsrrrrrrrrrrrrrroollkkkkjjjjjijimmmlnnmmjjhhhhr|^ov2CJ&%($'$'$'#&#&#)"(")!("(#) &/.7K_5cw-r"ghi i i g e b ` _ ] Y X Z~ W{ Vv Uu Sw SwTuTuSwSwRxQwQwRxSwSwUvUvTuTuTuUvTuTuTuUvUvTuTuTuTuTuTuTuSwSwSwSwTuTuTuTuTuStTuTuTuTuTuUvTuTuSwRvRvSwTuTuUvVwUtUtTuTuTuUvTuUvUv TuUvVwVuVu Tu TuTuTuUvTuTuTuTu RsMpJm!G`@Y&=L#:I&6F!1A&A9 < ;]cbionR^`IUWEPTCNRAOQ@NP?NM@ONAMO@LN@LN@LNBKNBKNBLLAKK@KIALJCNLCNLBMKALJAKK@JJ?II>HHGJ@1=?3@?4A@5BA5BA7@D5>B7>A8?B3@?/<;+;8,<90;9/:8-64%.,$"     .21ou|OU\06=.4;+42+42,66'11%).%).-*3/,54/14/15.570735:46;(07#+2#+2&.5)/4)/4*.3+/4-16-16+25&-0$+.%,/*,0,.2//////...////.2-,0)'-'%+*(.+)/,,-,,-0+-0+-../001+./'*+&(,(*.)-,)-,(-)(-),-*-.+/--,***$))#(&&'&&'&#%# ""!! (%'*-.-01+01(-.'+0%).#)0$*1#). &+")7AHON=NM@LNAMOCLOCLOBLLBLLDLLDLLBMKBMK@MKANL>NK>NK=MJ
  • KJ=JI;IK;IK9IL9IL=JI>KJ=JH=JH;GI:FH5FG5FG6DF6DF8ED7DC9BE:CF8DF7CE2BE0@C0@C1AD5@D6AE6?B6?B7??7??2?=1><.>;-=:.<7-;6'42!.,#%       *0/jryMU\.4A)/<+42+42)42'20&/2&/2(00)11000000222222.34-23&/3#,0$,3%-4'11&00(1/)20,21,21*/0&+,"+.$-0)./*/0///...------+/.)-,')-&(,(,+*.----,,,0,,0,,/--.,,-*,+(*))***+,,,,,,***,,,,.),.)/,(,)%'%%'%%%%%%%%%%& ! # +($,-*01.*/2(-0#,/"+.!*.!*.!*-(+"(/=CJAKXEO\DW^EX_GYdI[fG\eJ_hLajNclSfmXkrapvhw}t|x}}{}ˠ̗ҟ˭ѮҰͬɩ˫ͭϫ̩ͪ˧˧˧˧˦ʦʦʥɥ˥ˤʤʤȤȤȤȤȤȤȤȣǤȣǤȤʤʤȤȤȤȤȤȤȣǥǥǥǥǥƤťƤŤƤƣţţţţǣǤȣǡá⢡~j6dxK_6cuX|oY2k-f{8m:oIn}In}MnzLmyImxHlwCkwCkwBjvBjvChuBgt@et>cr;^r7Zn7Xl/Pd$IXAP!@L"AM(DL)EM'DN'DN(EQ(EQ)FR)FR*GS*GS+HT,IU,HV,HV-JV.KW.KU.KU1KX2LY7MZ8N[9O\:P]9Q^:R_9S`;UbAWbDZeL^iPbmVhs[mx[q|_udzg}pt~~{{{{{zzzzzzzyyyyyy{zxxwxvuuuutttttvuttsqoooooonnnnnnnnlkkkkkmmmljkkjkjijllmlmllllllkkkhhhikjsft|8FN&#(#(#&"%""""#####'#'$&$&&+).Oe1aw$nikkmm m l i g c ` _ ^ \Y W~ Sz Sx SxTxTxUv Tu Sw SwRxRxSwSwUvUvTxSwSwSwSwSwRxSySyRxSwSwSwSwSwSwTuTuUvTuTuTuSwSwSwSwSwSwSwSwRxRxTuUvUvTuTuTuTuUvTuTuTuTuUvTuTuTuTuUvUvVwUvTuUvUvUvTuTuTuUvUvTuUvTuTuTuStPr Oq Df;] 1M*F !A:; >5==5==6<;4:9398176-23',-$$     .21sv~SV^55?//9.21.21+42*31%20%20%20%20+10,21223223/15.04&/3&/3$02$02(1/'0.(00(00(00(00%.1#,/!-/#/1(00(00--.--..+/.+/.+-.+-,-*,-*).)*/*,,,,,,,,,,,,,,,,,,++,++,(,+(,+&,+&,+%*+%*+,,,,,,***'''%%&%%&%%&%%&$$$!!! (&&,,,///(/2'.1%,/#*-#).$*/#). &+$+;EL>MYBQ]AV_DYbEYdFZeH]fI^gLajNclPenUjsbpzgur|w|~rv͢ИƔЛʨΩϩϨΧ˧˩˩˪ΪΩ˩˩˩˧˧˦ʦʧ˥ɥɥɥˤʥɥɣɣɢȢȤʣɣɣɤʤʢʡɡǡǢȢȤȤȤȤȤȤȣǣǢţƤŤŤŤţţšššǡǡššàŸw]{BUI\Ivm~zY>k{,ez2k>p>pHnyGmxHlwHlwDmwDmwBjvBjvHivGhuEfsCdq?aq;]m7Zg2Ub*LU BK"?I$AK%CK'EM#EN#EN#DP$EQ)ES*FT*FT*FT*FT+GU,HV,HV-JV-JV.KU.KU0JW1KX4KZ4KZ5L[7N]7N]9P_:Q`;Ra?UbBXeE[hJ`mPfsTjwVoyYr|^vbzl~p{~}}{{{zzz{|||yyyxyxxxxxxxvusrrrrqqqsrsrrqoonoonlljjiiklkkkkkkjkkkmllllkklnmmmmljjjjjiggggiikkp|as~5GR+$'$'#&"%#####%#%#%"$"&$( #)-3Oe.`v%oikllm m l j h f c a ` _ ] [} WyTx Sw SwTxUvUvTuTuSwSwSwSwTxSwSwTxRxRxRxQwRxRxSyRxTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuTuSwSwSwTxUvUvUv Tu Tu TuTuUvUvTuTuTu TuUvUv Tu Tu TuUvUvTuUvUvUvUvUv Tu TuVwVwUvUv Tu Tu Tu TuTuVwJmBe 3T,M:8 ; QRKIGJ>GJ?FI>EH>DI>DI?EJ=CH?DG?DG=DG7@>5><6<;5;:6:9598478367034),-"#     .21uxUX`53942813.02--2-.3.(31)42'42&31+42+42223223001112+03+03(/2'.1).1*/2*/2).1'.1'.1&/2%.1(/2(/2+-1*,0-,0,+/,+/,+/,,,,,,,,,,,,,,,,,,,,,,,,)-,)-,&,+'-,'-,'-,&,+&,+%*+&+,&+.%*-%*+%*+'+*%)(#&'#&'&&'%%&##$!!"#)%%,,,000(00&..%,/#*-#*-"),#). &+$+;CJES[GU]DW^EX_EYdEYdG[fI]hK_jNbmRdoVhs`myfsrzv~{yy̞̗ȍȤέөϧ˧˧˨̧˨̨̧˧̧̦ͧͧͧͧͦͦʦʦʦʥɤȦȧɧɦȦȥǦʦʤʤʢȢȢȡǡǡǤȤȤȤȤȤȣǣǣǣǢƢƥǤƤƣţţšǡǡȠǠğà}R{5^nK_,Xlmvb9p'^s+bw6mEn}Dm|IlyIlyHkxHkxGjwFivFivFivFgtDer@br=_o9\i3Vc.O\ AN!>H#@J&BJ(DL&CM'DN'DP'DP*DQ*DQ+ER+ER,FS-GT,HV,HV,IU,IU/IV/IV1IV2JW2IX3JY3JY5L[7N]7N]8O^:Q`AScCUeEXfI\jLboRhuUkxXn{^tcyi{nvz}~{|{{zzzzyyzyzyyxxxxxxwwwwwwwvvvuuuuttssspqooonlljiiijkkklmjjjkkjkjlljkmmmllmkjjjjjlliiihhijjp|cu3EO*$'#&$&$&$"%##"#"!$!$!%"& !,%0Qb0du"lhkllmnn l j hf c a _ ] \Y| V{ Uz Vv VvVw Tu Tu TuSwSwTxSwSwSwSwSwSwSwSwSwSwSwTxUyTuTuTuTuTuTuTuTuSwSwTuUvTuTuTuTuSwSwTuUvVwTuTuTuTuTuTuTuTuUvTuTuUvUvVwUv Tu TuUvUvVwVwUv Tu Tu TuVwUvUvVwUvVwUvVwTuTuTuTuStSt Oq LnCg7[84 27@IL`ilZioFU[9RT9RT9PR5LN:DK>HOEJMHMPDNNEOOCPNBOMCLP?HLDBHDBHGFJIHLEKJFLKALJALJ@KI>IG=HF;FD?FB?FBBHGAGFBDHBDHBDHCEIDCGA@DCAGECI?ED?ED;FD;FD;DG:CF8AD7@C7??8@@8@@9AA6A?5@>5@>3><4<<3;;49<38;27:27:,36%,/#&    ///wu{YW]85>41:222000.21.21,21,21,21-32/32/32223223104104,14*/2(.3'-2,.2,.2+/.*.-(.-*0/*/2*/2,.3,.3../--..+/.+/.+//,0--.--.---,,,,,,,,,)-,(,+)-,)-,',-',-',-&+,%*-&+.(+,(+,')-&(,))*++,***(((&&'&&'%%&%%&&#%! %-& ..)11,)/.'-,%--$,,"+)"+)"**"**&+.AFIIS[JT\EY^EY^DYbF[dG\eK`iNahPcjXfn[iqflxmst{w~|~yr~áѡѕŊÞʨ̨̧ͧͥ˦̥˦̦̦̥˥˦̥˥ʦ˥ʤɦʦʦ̥˧ɧɦȦȦȦȦȦȦȦȤȤȤȣǣǣǡǡǡǡǤȤȤȤȤʤʤʣɣǢƣǣǤƤƣţţţţŢĢƢƠ Ÿ}n9ey4H,Zn`~}YEu#au,j~=o~?ADE>FF?GG=DG=DG>EH>EH=?I02<89G<=K@BFACG>CD>CD:CF;DG6CB2?>09<2;>6?C7@D4A?3@>5@>4?=3><2=;3<:1:8398287-32'-,#"    '+*^dkKQX39>06;.21-100010010/30/3104104222111222222.12.12,12+01(00)11(1/'0....---..///0-/3,.2,/0+./------.,,/----.../*.-*.-+0,*/+).*).*,-*,-*,,,,,,)-,)-,&,+&,+#*-$+.$,,"**&(,%'+)(,*)-))*''((%''$&'%%'%%###!!! (&&)-,,0/%0.#.,"-+!,* +) +) ),(+!+2;EL@MYGT`BW^DY`CZcD[dF]fH_hJbhLdjQfoUjs`nxft~m{ruz~~tqǡӕNjͬЩͨʩ˨̧˧˨̧˧˧˧˦Υͥ˥˥˥˧˧˦̦̦ʧ˩ɩɨȨȨȨȦȧɤȣǤȤȤȣǡǡǡƢǢǢǢǢǤȤȤȤȤȤȦȤƤƤƥǤƤƣţţšşßޞžž~`yDY7LUxw}[Dm}/ct6j{AnyAnyGlyFkxFivFivFivEhuDgtCfsBer@cp;^k9\i.S`%JW#CS>N'@J'@J)AN*BO'DP'DP'DP(EQ*DQ*DQ+ER,FS.FS/GT-GT.HU,HV,HV-IW-IW.JX-IW.JX/KY1M[2N\5O]7Q_;Ra;HG\ihZioIX^AVX>SU>PS:LO6GH8IJPMBOMCPNCPNBOM@JJ7AA4=@3FF=EE7>A&-079><>C?BC?BC?CB@DC:CFA5>A7??5==4=;2;91:8097)33#--%#     (,+`hoMU\19@,4;+42*31112223001../1.2304511511111111/23/23*22)11'0.(1/)/.)/.+/.*.----/////0//0../.././,./,./,./,......,/0,/0+./),-,,,,,,,,,++++,)+,),,,,,,(,+&*)&)*'*+&(,&(,'&*('++(**')+'')%%'$&(%'&&&%%%$$$ !*&$,-*./,&/-%.,",, ** ), ),!*- ), )-:CGAOYES]DW^EX_DYbG\eH\gI]hK_jNbmUeoYis`nvft|m{quy}{tǞИʉǣͥϫͩ˩˩˨̨̨̧̦̦˧ͧͧͧͧͧͦʦʦɧʩ˨ʧɧɧɧɩɩɧɧɧɦȦȦȦȦȥǥǣǣǡơƢǢǤǥȤȤȤʤʤȤȥǥǤƥǤƤƤƣţŢġÝwQv+P_&J[Aevywd7j}.at2hy7m~BlxBlxGjwFivFivFivDgtCfsEfsBcp=`m9\i-Ve'P_BOo,]AIIemm[knIY\CVWATU?RS=PQ;NO;NO>PM?QNBROAQNCPOANM?LKHH>FF:BB2<<5??5B@8EC;FD;FD?DG?DG>FF=EE5>A-695>B8AE8>=9=<7;:589478+25%,/'%      )-,imrW[`6LTDRZAV_CXaFXcI[fL[gM\hO^jQ`lTdnXhraoyft~lzrvy}~w}ş͙NjĥѰҩ˩˩˩˪̧˧˧˨̧˨̧̦ͧͧͧͧͦʦʦʦʨʨʨ̧˧ɧɩɨȧɧɧɧɧɦȦȥǥɥɣɣɤȣǤǣƤǤǦȦȤʤʣɤʣǢƥǤƤƣţţŢġàœyk-Uh-@=gzh~y_Agx3aw9g}AjzAjzGiyGiyHivHivGgwFfvEeuCcs?bo;^k2Zf-Ua>9F#>H$?I&AK&AK%BL'DN'DN'DN+CP,DQ/ER/ER/ER/ER0ET0ET1FU1FU1FU3HW3HW3HW3HW3HW4JW6LY7MX8NY9O\;Q^=Ra?TcEXfI\jTamYfr]jv`mydq}fshxk{lqx{}~xxzzzzwwwvvvxxxxvuutuuvuuuutrrrrqqqqqqnollllpppplkiiiijjklllmmmllllllllkkkkkhihhllmmmnnpv`ps5EH #$$$$!$!$$ % % %!%!%"%"%%(.1!R_2cpdehhlnnnnnnn k j h g e d a ^ ] [ X YX W X WWVVVXY [ [ [ [ [ [ [ [ [ [ Z\]\ Z Y V VWX YZ Z Z Z Z []\\ [ [\\ [ [ [ [ [ [ [ [ X Z YZ [ ]^ \ [ \^^ ] [ [^` ^ ^ ^``cddcbccccbU IxBGJejm^koMZ^EWTDVSDUTCTSARQARQERPERPFQOEPNDMPCLO@MK?LJ?MH?MH?NG?NGALJ@KI?JH=HF7@>6?=3><1<:/8;.7:+55$..("     $(']cjU[b5=D.6=,21-32.43,21*,0(*./+11-331131113.24/043154-/3)+/+*.,+/)/.)/.+/.+/....///000---,.)+-(,-*-.+.,,/--/,.0-/223334,+/('+*(.+)/,,-++,,**.,,0,,0,,,**)''%%%&&&'''(((*((*((*(((&&(&&'%%%%%&&&&&&%%%'"$% "!!%$(',/).1%.1#,/"+.(+(,)-*.(,%+7FLET`ET`BVaDXcEYdFZeH\gI]hK_jNbmOcnThs\p{`tg{lqux{|vx͘ˏūΩ̪̩˪̨̨̪̪̪̦̦̥˧̦̦ͥͥͧͧͦʧ˨ʩ˩˩˨ʨʧɧɧɧɧɧɧɧɦȦȦȥǥǥǣǣǣƣƤǣƤȤȤȤȤȤȣǣǣǣǣǢƢơţţŢơşnLfy )>)EZ_|~{f;ey+UiBl@j~IiyHhxHivHivHivGhuGhuDerBco@am9]h3Wb+LX!BN$AM"?K#@J$AK%BN&CO'DP'DP'CQ(DR+ES+ES+ES+ES+ES,FT,FT.HV/IW/IW/IW/IW/IW/IW2JW3KX3KX5MZ5O]6P^8R`:Tb>UdCZiJ_nNcrUgwXjzZp}^t_xb{e~horuxxxyzzzyxyxxxxxxxxwwvwwwvvuutttttrqqqpommmlllnnpppokkkkkjjiiikkjjkkjkkjjjiikkmlmlmmmmnnopw_nt5DJ !$ $# $##"#""#"#"""""%"%!#$& '-28Re-`shefgjmnoppq o p n m l k j i i d b__``bba`````ccbdccedddcfegfcabfdddefbcegggihgfdddefdgfdecedeedefigffiefeffgg jk j jnsoq+x,y-q*n?DGchk^hoNX_GV\DSYEUXDTWESUDRTEQSEQSGPSENQDMPCLO?KM?KM@MKANL@NI@NI?LJ>KIDI=CH?DG?DG?DE?DE9FE9FE7FE7FE8ED9FE:EC:EC5CE5CE3DE1BC0A@1BA:C?:C?:@?:@?9?>9?>9?>7=<3<:1:8.88-77'35!-/'(       "&%V^eNV]4;D*1:+25*14+25)03&,1%+0,.2.04111222222222223223/.2+*.,+/,+/+/.+/........./../---,,,*,'+-(,.),.)/--.,,.,,0..111...#,*"+)"+)#,*(,+'+*,**,**0,*/+)++$'' %( %( (+#(+#()&'(%((('''('$'&#'%%'%%'%%'%%'%%#!!")%%++,../&-0%,/"+. ),*)+*+))',+9FE?PWCT[@X^BZ`EYdG[fJ\gK]hK_jNbmRgnVkr]rybw~kzpuw}z~͙ъƒЧӱլЧ˨̨ΩϨΧͦΥ̧̦ͥͥͧͦͤͥΥ̧̦ͤͧͧͧ˧˧˦ʧɧɧɦȨʧɧ˧˦ȦȣǣǣǣǣǤȤȣǣǤȣǤȤȤȤȤȤȣǤȢƣǣǢƢơǡǡŠğޞv8bv 7K HaRz`?dy8f|;iBkzAjyFivFivHhxGgwCevBduS'?L(@M)BL+DN'DN'DN'DP(EQ(EQ)FR+ER*DQ+ER+ER/GT/GT/GT0HU/IV/IV/IV0JW2JW2JW3KX4LY8M\9N];P_>SbATbFYgM\hRamYgq]ku^ovct{av}ezg|jmpvyz||}}}{{xxxxxxxxvvutttvvvvuuttuusrpoonnnllllnnpppoklllkjjiijjiihhhkkjjijllkjlmlmlmmmnnnpxYjq.?F# "&!%#""!"!"!"!#"""##"$#%!',2!Uf.bsefgikmopppp n n n n npooonljjiigf gi f f f fee h hllk h gijkkk k k kl k klll j j j kl k k k k j k j j j k k k kll k k k j jkk i j l l m m m mnn m m l l m n o o n m k kljn)y9@C]dgdktQXaJUYITXIUWIUWKVTHSQGQQGQQGPSENQDMPAJMAJMBKNAKKAKKAKKAKKAKK?II>HH=GGFF=EE=EE;DG:CF8DF8DF7DB6CA:AD;BE:AD:AD;@A;@A???>>>>>>=====>==>:>=9=<0;9/:8.97+64)33#--'%     %)(`diW[`;?D15:-32,21*22*22)03(/2,12-23112112104104/15.04,.2)+/,,---.///000....../--/--.,,.,,,-*,-*-0(-0().)*/**/+*/++/.)-,%+*%+*!,*"-+$-+#,**+(*+(-*&-*&)(%'&#%( &)!'*"(+#((('''(((''')''(&&'%%'%%)$&(#%'"$$!!!)$&,,-../'.1%,/$+."),(+ ), **((+*9FE>MSETZAV]DY`EYdFZeH\gJ^iK_jNbmPenVkt]oybt~lyruy{|{vyҝБć¢ѫ֨ӨϧΫͭϪΪΪΩͧͧͧΧΩΨͦͧΧΧΧͧͧ˧˧˧˩˩˨ʧɧɧɩɩɨʧɧɧɤȣǣǣǣǣǣǤȣǣǣǣǣǣǤȤȤȤȦȦȥǥǥǥǢơšŠğŝÜzZt=V$C\a~{h8gy3bt8hw:jyFivFivIgwIgwHewGdvAcs@br9^m5Zi/Tc&KZ!?O!?O'?L'?L'BL(CM%EN%EN'DN(EO*EO*EO*DQ*DQ-ER.FS/GT.FS-GT-GT,IU,IU-JV-JV/IV0JW5KX7MZ7L[9N]GJ>GJ?HKBILAHK@HHAII?II@JJA;?>:>=<<<<<<<<=;;<8;<7:;2::199/86-64+42%.,'%     &*)aglY_d:@E17<-32-32/32/32.12.12112223215104-/3-/3,12+01(00'//*/0*/001.01../,-.+,,,------,,,,,,------,,,,-*,-*,,,,,,)-,)-,&,+&,+$-)$-)&-)$+')*')*',((+'''''&&&&&&'''&&&'''''(''('&*&%)&&&%%%%%%%%%'%%'%%%##" "!)%%,,-../&-0%,/"+/(,'+(, ** **$029EGAOWES[BW^DY`CYdDZeE[fG]hJ^iNbmPdoThs^mydsjzoruy{~qvǛ̍ ̫שҧШΩϪЪЪЩϩϨΧΧΧΧΩ˨ʦʧ˧ͧͧͧͧ˧˧˦ʦʧ˧˦ʧɧɧɦȧɧɦȦȦȥǥǥǥǥǤƥǤƥǢƢƣǣǤȤȦȥǥǥǤƤƤƣšŠğßÝ~\x$@U'?Yc{cEk|'Zm0cv>kv>kvHhxFfvFfvEeuDdtBbr=`m9\i3Vc-P];H>K"?I#@J&AK'BL&CM'DN)EM)EM+DM,EN+DN,EO+ER,FS+FP+FP+ER,FS*GS+HT+HT,IU/IV/IV2JW3KX5I[7K]8K_9L`=Nb@QeCUgHZlQ_nUcrYgv^l{]q|`tdxfzi}lpsuyxxxxxxxxxxxxxwuuutttuuyyxxvvtsqqqqnnnnpppopqqqoolmmmjjhhhhhihhhhhhjjjiiiihkkkkmlnnqqstxVip+>E "$"$"#!#!!!!!!$!$"%!$!##% )-48Tb)`ngdfhjl mnmn opprstsqoi b^ _bdhnoml k kmm m mnnmmmmnnnn l lmmmm l l lmnnnnmnmmm l kl l lm l k k klmmmm lmm l klmmmmnoonmmmmoou d/L-J?MIWAT >Q>UQh98<]\`ejsOT]AQTAQTFWXCTU>FF=EELHNOKQLLLLLLEMMEMMCLOAJM?HF=FDAFACHCDHGEIHBHGCIHBJJCKK=A@?CA7>A6=@:>=:>=8;<8;<79=68<2;91:8-86+64'43"/.&%       "&%YbfXae5FF@OUDSYAV]DY`CYdDZeGZhI\jM_jOalVdnZhralwhs~nyr}ux{}|stΞ͑‰åҬիԩҩҫϭѬЬЫϫϫЪϧΧΧΧΧ̧ͦͧͧͧͧͧͧ˧˧˧˦ʧ˧˦ʦʥɦȦȦȦȦȦȦǥƥƥƥǤƤƥǤƤƥǤƥǥǥǦȥǥǤƤƤƤƣţţŢĠŸ\u5N)F_^z|g>iy7br9dt>iyChuChuDgtCfsBerAdq8bn4^j-Yg(Tb?N=L#@L#@L$AK%BL(CM)DN+DM+DM-DM-DM-CP-CP,DQ-ER,DQ,DQ,EO.GQ.GQ.GQ-GT.HU/JT/JT/JT0KU3JY4KZ8M\9N]9N]=RaGSbKWfS[hX`m\fs_iv^nxbr|cugyk{n~rvxzxywxxxxxxxxxxwvvttttvuvwvvvvtsssppnnnnnnooqqoolmlmkkihhhhhihhhhihihhjiiihhkknmllnnoortyVfp+;E#$&"$"$"$!#"$"$"$"$"$#"$#**66"Wd,ancdegik m nmm opsuwxqaOzMx NrLp Pi Ng Lh\xh*tnmkll k k kmmmmlllll k k k klllll klmmmmmmmmllllmmnn k k klmmmmmmllllnnnoponnlllln!{P? "F<. 90:!8AE:EC;FD;FD;FD;DG:CF:@E5;@98E;:G=?D=?D7@C7@C8AD7@C7@C7@C4@B3?A3@?3@?6?=5><7<=6;<5;:4:9398398487265051*/+!&"  "!Y[`dfk?AF46;/32/32222222222111.21/32+42*31'20'20(31(31(22&00)/.)/.+10*0/+/.*.-(/+(/+$/-#.,#,/$-0#,/$-0%.,%.,)-,*.-*-.*-.)+/)+/&+,%*+$),%*-%+*$*)%+*$*)#,*#,*"+) )'"('"('$&*$&*&$*&$*%%&%%&%%%%%%%%%%%%$$$!!!" ($$'*+*-.#,/#,/!*.'+(,(,+*)($&8DF:KRBSZ=V_@YbAYfBZgC[hD\iH^kKanNbmRfq[mx`r}hzl~otw{stӞϏͥѨԧҥЧЧЪЪЪЪЩϨΨϧΨϧΧ̩ͧͩͨͩͧͧͧ˧˧˦ʧ˦ʧ˧˦ʦʧɦȦȦȦȦȦȥǥǥǤƥǤƤƤƤƥǥǥǥǥǥǤƥǥǤƢƢƢơššŠğޜZ|9J=NRtdEfz'Wm2bx;iw;iwDgtCfsDerCdq?bo<_l4\h/WcBSP=O">L#?M$AM&CO)DN)DN+DN+DN+CP+CP,CR,CR*DQ*DQ(EO*GQ*GQ*GQ*GS,IU/JT/JT/IW0JX1J[1J[2LZ4N\5O]7Q_V\$Q[#PZ539caglr~QWcDUVARS?PQ;LM:EI9DHCHKEJMGMLGMLCMMBLL?JN7BF,7;0;?:?@?DE@FE@FEAEDCGFCFGADE79=2486?=9B@8EC9FD9EG9EG;DH;DH9;G35A94C<7F;=B=?D7@D8AE7@D8AE6?C6?C4@B4@B3@?3@?4>>4>>53;;199398398287176+42&/-&$     \[_ihlDBH86<2061/5-23.34-23+01*/0+01)11)11'11'11(22)33*05(.3(-0(-0+./+./+./),-'-,(.-&..&..%,/%,/%,/%,/%--%--%.,&/-'-,(.-(-0',/%).$(-&(-&(-*)-)(,)))((($)*$)*"**!))"'("'(&%)'&*&$*%#)&%)%$(%%&%%&%%&%%&$#' # )%%***,,,%+0$*/)0'.'-)/*,)+!-/8DF>LTES[?V_AXaBXcE[fE[fG]hJ]kL_mRdoVhs_lxer~kxp}qvxz{wȝΉʩدקϦΧϩϩϪЪЩϩϩϩϨΨΨϨϨϧΧͧͧͧͧͧͧ˧˧˧˦ʦʧ˧˦̧̦˦ʤȤȤȣǣǣǥǤƥǥǤȣǣǣǣǤȤȤȣǣǣǢƤƤƢƢơǡǡŠğŞĞyWq#G_AYUzuzf;f},Wn4bv9g{BgvAfuBdtAcs:cr6_n1]k+We IY?O?O>N >N!?O$@N&BP(CM)DN)DN)DN+CP+CP.DQ.DQ,DQ,DQ(EO)FP)FP*GQ-GT.HU0HU0HU1HW1HW2HZ3I[4J\6L^7N]8O^:R_=UbDZgI_lObpSftVjuZny]q|auixjyl{o~ortuwxwwwxxwvvuuttttsrsssstttstsuursppnnmmoooommhhiiklmmkkihhggfgfihjjjiiiiiiijkkkmmmmpq|Tam#0<&#'!%"%!$!$!$!$!$!##%#&%( %/1;Ti(_tbccehj km mn oqtuwqNl-Sk,3:AH 4ICXMp'`jpnnl jlllllllllllllll kllllllllllllllllllllmm l ll klllll kllmmm lmm kl k k k i k lh ]6eUŹֹebl49BLQZ3P\1NZ1.7c`iuuVV`ITRFQOAMO@LN?LJ?LJ?LJANLCMMBLLAJMAJM>5==4<<49:389389389167/45+33&..'%      XZ^ikoACG/15112223445667-23)./(-0).1+01+01+03,14-16-16,1:',5))3((2-+1,*0)+/)+/)-,*.-)/.(.-&,+%+*(*.)+/$,,%--%--%--).1*/2,*0*(.(&,(&,*&,*&,,')-(*((('''('+)(,%()$'($&*$&*'%+'%+&#,%"+%"+%"+"$)#%*"$)"$)#!'# ($$***---%,/%,/!)0'.&.'/(,)-#-48BI?MWDR\AU`CWbDXcFZeFZeG[fH\gK_jSbnXgs`jwfp}mwr|ruxz}vϕȃ}˨ԧӪѧΨϩЩϩϫϫϩϨΩϨΩϨΨΨΪϪϩΩΧΧΧͧͧ˧˩̨̨̩ͨ˨ʨʨʧɦȦȦȦȥǥǤƤƤƥǦȤȤȤȤȤȤȣǣǣǣǣǣǤƤƣǣǤȣǣǠğޝ}Qset=ds:cr7`o1[o+UiMcF\@S>Q?L?L$@N$@N)AN*BO,BM,BM,BM-CN-CP.DQ+CP+CP*DR*DR(DR)ES,FT-GU/FU/FU0GV1HW1GY2HZ1J[3L]4N\5O]6P^:TbCUeHZjM`nQdrThsXlw[oz_s~fuixkzm|rtvxwywywwwwwwutttttssqqqprrssssssssnnllnmnnnolljkkknnnmlkkjhhhgghgghhhhgggghhhiiikknoopzS`l"/;&"&"&!$!$ # # & &!%!%!)#++55?!Vk,avbbbdgh kl lm oquuwch|x9?(EO)FP:M!K^Ru#^hmnnl k kllllllll kll k k k j kllllll k k k k k klllmm lml k j j j j k kl k l lll l k k l l l l l l k j kllg \/Q=]{UXf9:H01?%@Q/J[,)2^[djlxRT`HQTFORCMMCMMBMKBMKENLENLFKLEJKEINEIN?LK=JI9ID8HC8HC:JEJ:>J7;G7;G4>E5?F5DC4CB4CB3BA4@B4@B5@D5@D7@D6?C6?B5>A4>>3==5==3;;2::199389278137/15-32(.-&       TY\fkn:?B$'+/4,05,36,36)03%,/$*/&,1)03)03)03*14)2509<17>#)0! .'&4)*2)*2%.,%.,%.,'0.*1-'.*&*)%)('*+(+,&+,&+,',/(-0206-+1,(.)%+'$-&#,'%+'%+)&()&()''(&&('+)(,(()''($&+$&+$&+$&+%"+%"+%"+&#,%$(%$(%$($#'!'# #"&!++#---/-/)0&-%1$0&/%.%,;CJet>etb&?$=$+!(.6C-5BAR*L]&$*VTZ`gpLS\BST?PQ?MO?MOCLOCLOELODKNDJOCINAIPAIP?KM>JL9JI8IH8IH:KJ=IKB6?C8?B9@C7AA6@@5>A4=@4=@31:=09fr;dt9br6\t4Zr1Sk%G_>T=S>N?O#@L#@L%?L&@M+AN,BO-CP-CP-CN-CN-CP-CP*DR*DR(DR)ES*GS+HT+HT+HT,IU-JV-HY-HY.IZ/J[1M[2N\5O]7Q_?QaCUeKYhP^mRdoVhsYkv]ozas~cucwfzi}knptuuvtuutwwvvvvvvtsqqpppprqssrrrrppppmmmmlmmmlljjkkmmmmkkiiihjjiiihjjjjjjiiiiiikllloqyO`g-4 & $"  ! "!""#!$#&#*%,.36;'af/inb~cefhjjkkm opuvx pb+V@= "$,+=H0BMEX*ReW| _dhkll kl k klll l l klllm l l l lmnnnn l l k klll k klll l l k k kl lm k j k j lmnn no n m m n n nl k i i f fe bY S.M:+0?+ER-GTI_!Oe GLM[elISZARS?PQ=NO=NO?MO>LNDLLEMMDLLCKK=JNKJ=JI=JI>KJ;IK:HJ9GI9GI:FH:FHE7=D5=D5=D6?B7@C6?B6?B6?B5>A6.:<.;:-:9/99-77)42$/-'%    KMR\^c;?RmwlSr-Zl3`r;gu;gu?ct>bs<^t8Zp2Tj*Lb L">L$AM$AM$AM$AM'AN'AN+CP+CP+CP+CP+BQ,CR*DR*DR+ES+ES+ES,FT-GT-GT+HT,IU-IW-IW-HY.IZ2LZ3M[6M\7N]H@E@ECY$TjX~bflmmll k kl k k k k k jlll l lmml km l l l lm k kmmm l lmm lmm l lll k k j j k k j k lm n n m m m l m m k k g f f ffe] T}9]5Y!E]!E] H["J]OhSl#CEI[bkJQZARS?PQ>OP=NO?MO=KMCINEKPCLPBKO;KN;KN;KN;KN=JI=JIFMAIP@FM=CJ;DH:CG:BI:BI9EG8DF6DF5CE7CE7CE8AE6?C8>C8>C7=B8>C4@B4@B4A@4A@4A@3@?2=A2=A3<@3<@2;?1:>09=09=18;07:+55%//'%    JIM\[_L#?M!@L"AM"AM#BN&CO%BN*BO)AN)CP)CP'DP(EQ(DR)ES*DR*DR*DR+ES*FT+GU)GU*HV,HV-IW-IW.JX1KY2LZ5K]7M_9Oah2\ 5[=cFfKkRtVx"#KHLfgoQRZCQSAOQ@NPAOQCGL@DIHEILIMKKKKKK@ML@ML;LK:KJGKADL?BJDBHA?E?AF@BGE5=D6?C6?C5BA3@?3@>2?=2>@2>@1=?1=?/;=-9;09MSCRXCV]DW^HWcHWcLYeN[gO\hP]iTamXeq\jrcqyiwm{ouwz~vp̜ԂէԨիԫԪѪѩЩЫЫЪϫЫϬЩϨΩШϨϩЩЩЦϦϧЧШϧΨϨϧͧͥͥͥͥͧ˧˦ʦʨ̧˧˧˥ˣɣǢƢƣǥǥǤȤȥɥɥɥɥɤȦȤƤƢĠž~zxzz{|r7Ob(Aet~Uw@bs1Zq8ax9dt9dt7br5`p5_r.Xk!FSBO@L@L AM AM"AM#BN(BO'AN+AN,BO+CP+CP)DN)DN*DR*DR)BS*CT+ES*DR*GS+HT,IU,IU.HU/IV1HW1HW5KX6LY6LY8N[;M]>P`AScEWgI]hNbmTfqWitZlw\ny_p~bscvfyf|iloqrvwuvvvvvuussssssrrqqqqqpqpnnnnnnnnkkkjkjkkmmmnnnlljjjjjiiihhjjjjijgfffjkjjmlmnprxM[e%/ ! !!"!"!$!$!$#&($*& 00>>"[p)bwab`bgg jl mo opstwrjApT"YLN=KM=KM:HJ9DH5@DEHG+0944>;;E:>C=AF;DH:CG:CG9BF:@E9?D:AD9@C8AD7@C8AD8AD8AE6?C6?B6?B5??5??4>>3==3Tg?YgE_mGcqJftQhwTkzZo~]r`vcydze{ijmpsttuwxxwuussrssrqqtssssrrrppllllljjkmmmllmmmmnmnjjjjllllllljjjklkkihhhhhjkjkklnozKYa$,  !!!!  $ $ $"&%&()08%CK(av+dybbabfg jl m m moruuqi_Bt R!WR,cALU`GP[@RU?QT8NS3IN+?D';@2@B;IK?LJ?LJ=KM=KM:KL7HI4A@3@?IG7B@9DB8AD8AD8AD8AD:AD:AD9@C:AD7AA7AA7@C8AD7@D7@D4@B5AC3@>3@>2=;2=;4<<3;;4;>4;>1:=09PS6OQ3LN/KK/KK6MI7NJ;LM;LM;LM;LM;KN9IL4EF5FG8HE9IF=JI=JI>GK?0AB4AE5BF8AE8AE8AE8AE9BE8AD8BB7AA7AA5??5>A5>A:>C:>C8>C8>C4A?3@>1><1><3:=3:=48=6:?49<5:=18;07:,58*36&24".0&(     EEE\\\:CA+42,36+25/45.34/32,0/+/.,0/000000,0/,0/(00)11(22&00'0.%.,)+/)+/&+.&+.'+0(,1(,1'+0(*.')-'+*(,+)-,(,+++,))*)'-(&,+'-*&,*'+)&*+&(+&()&()&(%'+#%) %( %(%#)%#)$"(%#)%#)%#)%#)%#)%%&%%&'%%'%%%%&$$%"!%"  %!''%+*(.$*/#).!*.(,&*'+'+'+$+5=D=KUBPZBV[DX]DY`EZaDZeE[fE[fH^iNclPenXhr_oyhvm{rvvyx{ppԌ̩ثөѩѩѩѩѩҨѪѪѫЫЪϪϪϫЪϪϪϪϫЪϫЬѫЫЬѬѫϫϩͩͪΪΩΩΩΩΩΩΩΩΨͨͨͨͥ˦̦̥˥ɥɧɧɨʨʨʧɦȦȦȤƣş}|zzzwvsnmmpoqrqqpollkkgfijhhkiklqrvuzyzzzzzz||||z{{{z{||xyy{}|}}~l%bzL!=K">L#?M#?M$AM#@L$AM%BN&CO'DP'CQ'CQ-BQ-BQ-CP-CP)DN)DN(EO)FP,FT-GU-GU-GU.HV/IW/IV0JW4KZ5L[6M\7N]:O^=RaAVeEZiH]lLapVdtZhx]k{_m}bpesgvixkzn}nopqrtvwwwssrssrttstsrppnnnnnnnnnnoonnnmkljjkllllljjjjnnnnnnnnmmmllkmmlkmnonnoooprzDRZ   !"# " " &%()"(#)19!?G#\q)bwbcbceghj kllmqsuql hige`^_`ehikkjjjjkl m m m m m l l l k k l k k l klllllmmmmmm l l lmm l l l k k j k k j i jkkll k j h g g gg f f f f gfeffffffgghihggf@DI\dqNVcBRU@PS9NO8MN9MK9MK=OL;MJ?LK@ML=LK>MLJL=IK;GI9EG;DG:CF7DC4A@5BA7DC8CG8CG9BF9BF8AD8AD:AD;BE:BB9AA3@?3@?5>B5>B7=D7=D5=D5=D3?A2>@2?>1>=1;;0::/8;/8;39@4:A29<18;-55+33*14%,/&$    CFGbef=FD1:8,51,51145256//0,,--*..+///0//0//0../+03,14'03$-0&+.%*-').(*/%).&*/'+0'+0(,1&*/(&,'%+)(,+*.++++++*)-('+(&,)'-)&/'$-)%+)%++&(+&()&()&($&+#%*"$)"$)&#''$('$('$(%$(%$(#%)"$(&&&%%%%%%%%%%%&$$%!!"  " &%&.()1#,/"+.+-')%,%,%.%.*52=H5GR>P[>W[@Y]?Xa@YbB[eC\fD]gF_iHakLeoUitZnyfukzmprtpqrє~Ʃت٭ӬҩϩϨѨѨѨѩЩЩШϨϨϩЩЩШϨϨϪϪϫЫЫЫЬЬЫ̨ͪΨΧͧͧΧΩΩΧΨϨΧͧͧͧ˧˧˧˧˦ʧɧɨʨʨʨʧɧɦȨʨʢĠ{{wtsollfa|jkh~f|g{j~jia{`z`z`zc{d|d|bzbzbza|`{a{`zd{d{hzk}m}m}jzjzhzj|hzk}p~p~r}r}r}r}p~p~qqp~qs~s~tvvwxxyzyyz{{{|||||~Kly'4'KVg}^{:]q8[o:bu9at;]m6Xh3Rd&EW>K?L @I!AJ"?K#@L&@N%?M'AN(BO%EN%EN'DN&CM*BO+CP-CP-CP-CN-CN+DN-FP*FT+GU+GU+GU+GU-IW-IW.JX/KY0LZ2M^2M^3O]5Q_9Uc=Yg@\jEaoOdsRgvThzWk}Xo~\s]v`ydzf|j}lmorrttttsspqssrrssqplljjllnnoppoqpppoollhiiijjjjjjllnnnnnnnnoonnnnnmnnnnlllmoopr}@OU ! "!"!!$!$&&() ,#/5A!BN%`v(cybcccdfhj jk lmrtts m jh gifdgffhi k l k j h i k k k k k k l l k lllkk k k klllmm o n o n n nl k k k l k k k j k j j j j j j j j j i k j i h h hhh g fg eefefeeffffee d dfe27:U^iLU`@OU>MS=LR=LR>NQ=MP@MQ>KO@KO@KO?MO?MO=NOHP=GO:CN9BM9CJ9CJ6ED6ED5FG5FG9DH8CG9BE8AD:CA9B@;DB:CA7AA7AA1?A1?A1?A1?A5??5??4>>5??3>B2=A2=A1<@0;?/:>/8L >L#?M#?M'>M(?N'AN'AN'DN'DN'DN&CM,BM-CN-CN.DO/CN/CN.DQ.DQ+ES,FT,FT,FT+HT,IU-JV-JV.JX0LZ1M[2N\6M\8O^;Ra>UdE[hI_lNaoResUhvYlz[oz^r}`u~cxixkzm|o~prtvuvturrsssrrqqqqplljknnnnpoooqqpqonlliiiijiklllnnnnpppppppnnnnnnmooonmmnnoort}AOW #  "   #" # #''#)%+6?%GP+c|+c|abbbfhhhijnpsut q nj h g f f f f f f ghkk j i h ijj i i ijjjk j ij m m mn lmllllmmnnm l k kl k j j j j k j k k i j j j k j j j j i g g g gfffeeefff e deffee e edded.21AIPGOVCPVBOUCNRCNRDOSCNRCLPCLPBKNCLOAMOAMOAMO@LN?JN?JN=GN>HO?FO=DMA5B4=A3<@1:>09=/8<.7;26;26;556445333222-01(+,%#    @>DgekKOT26;+33*22/15-/3,*0+)/+)/-+1.-1-,0+-1+-1,.3-/4*,1(*/%*-&+."-+"-+#--#--#,/#,/')-$&*%%%''''''((((&,(&,(%.(%.(&,(&,'&*'&*+%*+%*+%**$)'&*&%)#%)$&*"$)"$)%!'&"((!()")%#)&$*%#)%#)%$(%$(%%&$$%##$!!"!"!" % "$'((+,#,/"+.)-'+%,%,"%-!$,$-7L">L#?M%AO'AN'AN*CM*CM-CN,BM0AO1BP1BP1BP1BP1BP-CP.DQ-DS-DS.DV/EW.HV.HV.HV/IW0IZ1J[3K^3K^2M^3N_5Q_9Uc=Yg@\jF`nJdrNhvPjxSmzUo|\r^tcvfyj{l}nosututuutrrqpppqqqqnnnonnnmlmlnooonppnnmmmmmmooppoppppprrrrrrrqqppommmlkjmnnnrt|?JU "  ""!"##%&"(%+8A*LU-f|*cybb``df fgiknortsq m j g f f fee f f fh h i i ijjj i ij jkkk j j ijlm mnnnmmmml kllm l k k j j j j j j j k l l l l k j j i h g f f f fh ge d d ddddeeeeeedcccdccb`111NUXOVYDRTCQSDPREQSFOSBKOCINCINCINEKPAMOAMO?MO>LN=KMGKC9?D8>E9?F7=B609<09<18;07:/77.66333222422311-01),-&"    ;8<_\`FEI437-23,12.04+-1)+0)+0*,1+-2*/0*/0).1).1*/2).1(-0',/'-,'-,'-,'-,'-,'-,&+,%*+%*+#()"('#)(%)($('('+('+(&,(&,)%+)%+(%))&**%'*%'+%*+%*'%+&$*#%*"$)%#)%#)&#'&#'&#''$(%$(%$($"(#!'$"(%#)%%%$$$###!!!"#!"! # $'&**)-#,/"+.)-'+%,$+!$,"%-%)57;G;HTBO[@T_AU`@VcAWdBXeCYfE[fG]hL`kOcnXgs^myetjyl~ohqtΑƊƮݪ٭ѮҭӫѫҪѪѪѪЪЪΩͧͧͧЧЧЧЫҪѪЪЬЬЫЫЫЬѬѭҭҬѪѪѩЩЩϩϩϩϫϫϩϩϧϧϧϥͨΨΪϪϩͩͩ˩˨ʨʩˮЬΨʛ‘y\Eh0V|)Ou+Xw'TsUnUnPgOf%Mf&Ng/Pj+Lf/Le1Ng0Nd3Qg0Nc,J_/I^,F[,?Z+>Y)Y$YjF]lJapPetRgvTixXm|\n~`ratexhyj{l}noqrttustrrppmmnoqqppnnppooooooonnnmmnnllllmmoonnpqrrqqrrrrqqqqqppolllkmmlmmmoq~;EL !"#""#### $$'"%;?*NR&bv'cwbbabeffgik moqtsq mh f e e eee g g f ghh ij i i ij j k l l j jk i i h ij l l l l k k k klllll k k j j j k i i i ijkkkk i i i h f f f fh gff e edfed abddeeeed c c caaa`888bdh\^bGUWCQSBOUANTEINAEJEDHGFJFIJHKLAMO@LN?OL=MJ@KI>IG=HF>>????>B>=A;=A;=A7<=6;<3;;4<<53:=199199278278169/47333333222222)20%.,(%      206][aHEO30:-38*05)11'//&-0'.1)11(00'0.'0.)/.)/.)/.)/.).1(-0*,0*,0---,,,,,-**+&(,')-%).$(-$),$),$)*#()%',&(-)'-(&,'%+'%+*#**#**#**#*(%))&*$'("%&"$("$(%$(%$(%$(%$(&#%'$&'$&'$&%$($#'%$($#'$$%##$$#'"!%!!! &""(%',)+%+0$*/ )-(,%,$+!$,#&.&+45:C;HTANZ@U^AV_@VaBXcBXcDZeG[fI]hQakScmZhr`nxfslyo~p\ym}ϖ{ɧݬרӫҬӮҭѬЬЬѬѪΩͩͩͨΨΨϨϨϪѪѪѬѬѬѬѫЬѫЬѭԭԭҭҪѪѧЧШѨѪѩЫЫЩЪѧҧҩЩЩШϩЩЦΥͤʥˣɧͬԭբϙƅv`Gn#W{<`4_ =h#Kk.Vv6[pABJEINFJO@LNAMO@MK?LJ;HF7DB7DB9FD7GD7GD7EG7EG9EG9EG;DG:CF8AD8AD:@E;AF=BE?9>?9>A9>A;=B;=B;=A:<@9;?68<59>6:?2;?2;?2;>09<39839838;27:248137043/32222222111,,, ("   63B;=A;=A;=A:5:=29<29<29<3:=28=17<57<46;46;35:138027034/23/32/32-32(.-''      ?:CrmvTP]2.;049,05+03,14-25,14+03*/2-,0,+/-,0-,0.-10/3-/3+-1+-2*,1*,1)+0+)/*(.)&/*'0+)/+)/*)-)(,+(,*'+*&,*&,,%.+$-+$-+$-)"+)"+)#()#('$((%)&$*%#)%#)%#)%"+%"+'"+'"+("'("'("''!&&&&&%$$#% "&!###$!!"!!" !&!#''(++,&)1%(0!&/$-".#/%,%,"'07U.>U8G[>MaDQdFSfJRfLThPTfPTfQTiQTiSVkSVkSWiTXjVZlVZlW[mY]oW^oX_pX_pY`q[au\bv]cw]cw]fw]fw^hu`jwdk{el|fm~hoiq~jrhtjvgwhxlzlzo{o{q}r~uwz|{|i~%:P!9Skr`*Th.Xl2[r,Ul/Le =V#@D=?C>=A=<@:<@:<@6:?6:?69A58@6;>5:=49<49<38;38;86<75;64:64:64:539437437034/23/23/23,14',/!&)     I@GtkrWMW6,6428206.05/162060.4.-1-,0/,0/,0.+-/,./,.1.00/3.-1-,0,+/,+/+*.*'1(%/-$2.%3-)/-)/)(,)(,*'+*'+)%+)%+,%.+$-*#*+$+)"))"))"))")'#)'#)'#)'#)'"+'"+)"+)"+)"+)"+) ') ') ''%'(&'&$&$# "# ""!% # #""(!#(%)-*.()1&'/&/$-#,$-$-%.%)56:FAKXDN[DU\EV]BVaBVaCVdDWeFZeG[fJ^iNbmZhr`nxbt~gyKk{Ggwėףٌ—ɭ߮תӪѫҭҭҬѬѬѫЫҫҫЫЫЫЩЩЩЩЩЩЩӪԨԨԨѧЪѪѬѬѬѬѫҫҫҫҫҫҪӪӬѬѭҮӫҫҩҨѨӦѪѩЪϲ׷ٹۤ̓l8Ys3b@o<[NmXwZyZ{Z{Z{Z{YzXy[y[yXyWxWxVwVwUvWvXwVuVuPsOrNsMrPq~No|No|No|LmzJkxIiyHhxDdtBbrAaq=]m7Yi4Vf1Ta-P],O\(KX)EZ!=R!7Q1K3I"7M0BT8J\AL_BM`IN^JO_JN`KOaLPbMQcMQcNRdSReSReWSiXTjTVhUWiOXiPYjP[nR]pW]qX^rY`q[bs]br_dt`eubgwchxejzdk{fm}gqhrfqhsiukwnxoypzr|u}v~yz{|Zk+FK^yrx=gz/Yl3\s/Xo3Ne ;R%;N'=P(=L)>M+=M+=M+=M,>N-?O-?O,BO,BO)BL*CM+DN+DN*AP+BQ+AS+AS,DQ,DQ/ER/ER-DS.ET-GU.HV/IW/IW2HZ3I[5H\6I]8K_9L`;Kb>NeEQfJVkM[kR`pPcqTguXiw[lz_m}bp`sbudxfzg{j~noprqrrrsssrrrrrrrrqpqqqqpppppppppnnmmlllmmnnnpoooopnnlkjklkoponppnmmlllmmrt}z(6@') % %   " #"%((((AG)SY$e}#d|ab```bfg ik moqrq m kf e eee d d deef f f g g ghh g e e ghhi g gh g gh jlkk ij k kl j k k j jj h g g g f f ffff ec bb `a `^_bcbacbbaba a a ` ` _``` ` ``````` _`333_af^`eOU\LRYEOVCMT?MO>LNANLANLBOMBOMCMMBLLAJNAJN=JIBG>BG:CG9BF6BD6BD8AD9BE>BG=AF=BE;@C8A?7@>7>A6=@4:?39>09=09=1:=1:=0::/9918;07:169169359359248248256145043/32.36-25*14&-0'%       =5:kchYNU7,36/86/8215326001../,+/,+/--.,,-++,,,-.-10/3.-1,+/*)-)(,/).0*/0)2.'0+%0,&1+)/+)/)(,('+('+('+(&,'%+(&,'%+&$*'%+&$*&$*%#)%#)$!*$!*'"+'"+)"+)"+'*)!,)!,'** *))(((('%'%%#&$%%&&" &!%#"! $$&+)+0%+2"(/'.%,%-$,$,%-*51R]AU`AU`AU`BUcDWeEYdG[fJ^iNbmThsYmx[sVn{Lo`ݙێĖ̩֬ٮӭҮѮѬѬѫҬӫҫҬӫҫҫҫЫЫЫЫЬѫЫЩҪӪӪөЪѪѪѬѬѫҫҫҬӫԫԮծխҭҬѬѭҮӬӭԬӫҪѨϩέҸՉ2R|!Ak(V/]DmNw^{`}ba~a~bb_|^{^{\{ZyZyZyZxZxYx[z[zWvXuXuUsUsRsRsVrUqVp~Vp~Ro{Ro{Po{NmyJkwIjvDhsAep@cp=`m;Zl6Ug9Uc4P^5MZ1IV,EO+DN&>K7D)=-A+4L6?WD^?H`?H`>J_>J_?K`?K`?K`?K`DNcEOdFOgGPhAQhBRiDSlETmGVoGVoOXpQZrR]pS^qS`sUbuVbwXdyWgwXhxYiy\l|^n~`pbqcrftgukvlwnzq}rtsuy{|Gat!;NRqt_Ggw;Xq;Xq9Sh'AV)?R(>Q)>M(=L(=L)>M(?N(?N)@O)@O(?N)@O)@O)@O(BP(BP(AR(AR+AS+AS+CP+CP,EO,EO,CR.ET*EV+FW,GX-HY0H[0H[1H^2I_5J`6Ka6Ka7Lb>QeAThEYkJ^pKbqNetPgvRixUk}XnZq\s^u_vdyf{h}jklmopprrrrrrrrooooonnnppqqnnnmmnpomllklmllkklmkkjjihhhhikkmmlllkkkmlllllpq}z)8> "!"!  "#' (&( "BG(W\#d|!bzab``abfgjk moqrp n j g f fe d c dee f g g f g g gh g g g g giih g f f f f gjj j i i j j k k j klkj h g g ge ddcbaa `__^^__``bbbaaaaaa ` _ _ _ ^ ^ _ _ _ _ _ _`aa` _` _...XXXbbbQVWMRSDNUCMT?OR>NQ?OR>NQBMQALPALPALP@LN?KM=KM<4<<1993893892::19918;18;097/86.73.73184184265154154043/32/32-23-23$41 0-+(      5.0f_aVOP+$%0,*51/222111//0,,-+++,,,,,,,,,,,-,,---.../,,,)))*)&*)&+,)+,),+/*)-)&/+(1*)-*)-**+**+))*(()(((((((()''(&%)'&*&&'&&'&%)%$($"(#!''$('$(%%&$$%$"(#!'' '' ''"$'"$# $$!%# $"##%"$#%#%"!% # """)&(-*,%).$(-%1".".".#,$-#)55;G?HSBKVCQ[FT^AU`BVaCWbDXcGYdI[fN^hRblWho^ovSjy13EA7IG=OE@OGBQ>DQ?ER9ET;GV7GW7GW?G[@H\CJ[DK\CM\CM\DN]GQ`MRbMRbOSeQUgQUgSWiTXjVZlY^nZ_oWapYcrTesWhvYjx\m{am|bn}cp|er~ksmulymzk}nmoy{~e~5F2H[m~fw@WmAXn9Uj-I^(AX$=T#=P#=P&>K'?L%?L&@M%BN%BN%AO%AO%AO%AO'AO'AO+@O+@O-BQ-BQ+CP+CP)DN*EO(EQ*GS+GU+GU/EW1GY1GZ2H[3I\4J]3K^3K^4L_6Na;Ra>UdE[fH^iNbmQepSftTguXjzZl|]q|`taucwgyi{k|m~nnprststttttrqqqqqpqpqqqqqppoommmmmlllllllkklllllllkkklmlllljjjilklllllmor{|'89 ! ! ""%&!(&'&'FD(WU`tbvababacegjklnpqq m lg f e d d deeeee f f fh ghhh g g g ghh gh g g gi jkk j i i ikj ij i i hh ff efedc_ ^ \^`` _ _ ^ _ _`aa abb ` ` ` ` _ _ ^ ^ ] ]^ ^ ^ ^ _ _ ` `a` _ ] [,,,RRSgghSUYOQUFORENQCNRCNRENRCLPCLPCLPCLPBKOAJM@IL@IL@IL@IL?HK>GJ1:=38;38;38;38;199199199088-77,66+55+55,66,66-55,44.43-32/23034223223+2.'.*)#!     ,')^Y[NJJ)%%//*22-2/30-1/+1.*0,,,,,,,,,,,,',-',-&..&..$,,!))$('%)(+++,,,,*0*(.*(.*(.*(.*(.*)-)(,))*''('''''''''''''$('$('$((%)%$(%$(#"&$#'$$%%%&"%&!$% #$ #$ #$ #$""#!!""#"#%$& %%$$#$#$#$$##  ! $'&*+*.$*1!'.#0#0#.#.$,&.",41;C8HR?OY>S\AV_AU`BVaBVaCWbGXfIZhM\hRamTguYlz?]s,J`fۇ‰ܭݦ֭ԭԭԬӬӬӫҫҬӬӫҫҫҪѫҪѭҭҭЭЬЬЬѬѬӬӬӭԬӭԭҭҫԪӫլ֬լլլծխԭխխԮծծխԭԱֺ|-@i7t:TSw]gfjiji~h}f{gyfxewdvau`t\s\s\s[r\p\p]o\n\m[l[lZk[mZl~Zl~Zl~Yn}Yn}Vm|Vm|Rn|Rn|Rn|PlzPk|Pk|NizMhyLhvLhvKguJftFdtDbr>\q:Xm3Th0Qe1K^,FY*EO%@J!8G3B%0H)4L38N5:P3?N4@O3AP3AP3@S4AT7@X8AY:EX;FY9GW:HXI\DJ^EK_ILaJMbIOcKQeHSfJUhNVjOWkPXlS[oS^oU`qXctYdu[fw]hy_j}`k~dpfriskupwryr|t~y{}~|@Vh7LKezug>`q:\m3Xg*O^)DU&AR'=O'=O%?L&@M#@J#@J$AM$AM"@N"@N%AO%AO(BP'AO*?N+@O+@O,AP)CP)CP'DP'DP&DR(FT*EV*EV-EX/GZ2H[2H[3I\4J]2J]3K^2L_3M`5Ob8Re@WfCZiH_nJapMdsPgvUi{Xl~[q~]s`satdwfygyi{j|k}oqqrssststtsqqopooonpqsrrrpppoppmmlljijjiiijjjijijklllononlkjiiijjlllmnp~~)26 !! !! "# $!% #% !#EG&VX"c{"c{bbbb bceg hj jn oqp n jf e d b bbcdeeeef ghhhhh g f gh h h i i i i i ijk k j j j j j i i i h g ff e c aab_ ] Y Y Y [ \ [ Z Z Y Y [] \ \ \ ] \ \ ] ] \ \ ] ] \ \ ] ^ ^ ^ ] ^ ^ ^`` _ ^ ] \+++QPTfeiSUZNPUCMTCMTANT@MS@JQ?IP?IQ?IQAIPAIPBILBILBILBIL?HK>GJ?FI=DGACG@BF=BE5><7:;69:57;46:35946:38;38;088.66-55-55,36,36,36,36,36,36-32-32/23/23/23/23,0/)-,) !      (&,^\bJNS*.3,14*/2.,2.,2,*0,*0,+/,+/,+/,+/(-.(-.&..&..',-%*+&)*'*++*.+*.*(.)'-,(.,(.+'-+'-)'-)'-('+&%)''(''(&&'%%&&#''$('#))%+'#)%!'#"&#"&##$$$%!%$ $#%#%#$##" #"$#$!#$!#"!"!#"#"%#%#"!! ""#$'((+,"+/ )-%0#.#.#.$,$,#.-8C8JU?Q\:TZ_7XHk[~ihkjihkh|fzdxewcuar`q`q^o\m\m\n[mZl~Zl~\k~\k~\k~[j}[j}[j}[j}[j}XjzYk{Zl|Zl|Wl{Wl{Vj|Vj|Ui{ThzSi{RhzRh{Rh{Rh{QgzQgyPfxLhvJftFdrDbpB`p=[k9Ri3Lc/KY)ES'BL"=G"6A#7B)5D+7F-9H0I-?J2=P2=P4R5@Q6AR6AR7BS7AV8BW?DZ@E[BIZDK\CL]CL]EMaFNbHOeJQgJTiLVkMWlOYnS^qU`sWbuXcvZdy]g|`k|bm~fohqlunwnyq|swz|m}-@V*=StyYs>Xk6Un.Mf(C\"=V";R";R%?M%?M%?L%?L&@N%?M$?P#>O$?P$?P&@N&@N(?N)@O)?Q*@R'BS'BS%CQ%CQ&DR'ES*FT*FT-EX.FY1F\1F\2H[3I\2J]3K^3K^5M`6Na9Qd>TgBXkE[mI_qNbtQewTfxXj|]m}_o_q`rascufxgyhzj|lmnnqrssssssrrpoonnnnnpprrppoommjkjkjjllllklklkkkkkkmnmmmnnmlkkjllnnnops~"*1 !$! !!" $ &!' ") !(CJ(V]$e}"c{bb```bcdfghj mpo m j g e c c ccccb de e f f g g g g g f g gh i h h ikjj i ij j j j jk i g gf d b _ \ [ W V W WWW T TUVUUU SUV V V V V WX XY [ Z [\ [\ Z Z [] \ [ \ \^^^_^^^ ]/ conn= count=op=ver=T[Sc[Sf [SH%[S١c[SU& [SL [Sw / conn= count=op=ver= [S#/ conn= count=op=ver= [SZ#2/ conn= count=op=ver= [SR# / conn= count=op=ver= [S"#'/ conn= count=op=ver= [S#g1/ conn= count=op=ver= [Sg#k8/ conn= count=op=ver= [SE%?/ conn= count=op=ver= [SZ%G/ conn= count=op=ver= [Sna%TP/ conn= count=op=ver= [SUl%¸)compression=noneop= size=ȹȹ3 conn= op=topic=/camera/image/theora1callerid=/camera latching=0'md5sum=33ac4e14a7cff32e7e0d65f18bb410f3message_definition=# ROS message adaptation of the ogg_packet struct from libogg, # see http://www.xiph.org/ogg/doc/libogg/ogg_packet.html. Header header # Original sensor_msgs/Image header uint8[] data # Raw Theora packet data (combines packet and bytes fields from ogg_packet) int32 b_o_s # Flag indicating whether this packet begins a logical bitstream int32 e_o_s # Flag indicating whether this packet ends a bitstream int64 granulepos # A number indicating the position of this packet in the decoded data int64 packetno # Sequential number of this packet in the ogg bitstream ================================================================================ MSG: std_msgs/Header # Standard metadata for higher-level stamped data types. # This is generally used to communicate timestamped data # in a particular coordinate frame. # # sequence ID: consecutively increasing ID uint32 seq #Two-integer timestamp that is expressed as: # * stamp.secs: seconds (stamp_secs) since epoch # * stamp.nsecs: nanoseconds since stamp_secs # time-handling sugar is provided by the client library time stamp #Frame this data is associated with # 0: no frame # 1: global frame string frame_id "type=theora_image_transport/Packet& conn= op= time=[S%[[Sn$image*theora(|& conn= op= time=[SR4%k[Sn$image:theora+Xiph.Org libtheora 1.1 20090822 (Thusnelda)& conn= op= time=[S% [Sn$image theora(kIJs1R!1b!@mSgVx9[l*hT()$Zy9fS xU)$|<AV* b!|< @86y,a/ǃbVB2E瓙e0%R8H!j4 b@F"`,@!AAP!QQ@!AQQP1AQQQAQQQQQ!1AQQQQQAQQQQQQQQQQQQQQQA!QA1a1Aѱ31pSa5u!bSFtт3tvwT'Fv11111111111111111111111111111111111111111111111111111111111111111!!Q!AaQa!aBBBA!A"BBBAaBBBBA"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBA!6661!Q&666166662&66666666666666666666666666666666666661QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ!!!Qq!!Qq!QqQqqсᑱAqAq!Aq"QAq"RQq"RRQ"RRR"RRR"RRRAAAA|^\t}^?/f'|{rE7~DR4̮؄ La Rw;i]/GPld~rbWGy' UHAUHƂ3҃]XVy̱R"P Y4GxþG+1g oPY]Jw #͵I2ߎLbU'"Lcbusi.webHVr.egEva4mʣ(TF匷} Mi;:Zt|*Rz1jɦtavV=hK 5='$Mu)UsCa4{Z̷?;G3+\h&i=Z _|G|YeJXu| UsYixmG'=pU mvF~a nc SP cIk,:=E d63L塎?#=Э4\XM?hSP9to8R:>! ڤM.een)PM+mt<cAedzRbH6+Iʈ[u~a+W`APޥ0k෧ވK ͵Jl)FJP$^!g/9N߫xcU8$/Jm3QsVFǕ)#H2imqKGBbimh@R:iIMa4 p{YY`DHJmc*˿0M+mt4T_~ 1AmyUHFHJi3ms,p!v/{W 1j f˖#´/z8q1mF /Gʚ>#q<9U$OQ mY4/끦m07$hOeDO-a\8UIedBsᶪ^3c^Jւ6+IkT[wk0]}5Ͽ>:{}{:5wnb}W=mzyyo}_g'/߿}w}po}߼}xs<x}h>x}>}>}>xxx}>zx } @>(>>>{k!>o>ݾ{v>3\g6=w9.C}ӛyzv{!^""`s eT* Mf1PA0f\%,0'}G-3SO잳8!`=`ɉצ:`Zi,YܣS#^ wPIQfӴ a_0mw_7WMu~0 ǜsQgN@`GhŊzǑ=} הd[R~#F;=lTmm !%gP) A7x!b\sǮEfYlgf`X22gcuivGX9g0>RS(^œ ̔Č K Uvh/@խ'/@RŌ1+YMoA^W}wozŃ"Hy1#%մ2 (P9dV@2k`U;9N2J`Hn)j hٳGmrm&-fM@&f&žGm6aw:m1,A3*F 2—OO*2TR*.n#1f5 ق)$BB$6j/}wOlym[DM6m kjM6Ͷmbmf͉ͶYG[&-m6Em7 jyAA"͕n,9)ƀq.;mlos%k#Zd^ ºoa(LNk4 k6[4Vl٭k6oKmŶu:l\;pK4W6bmaD7ux t/0t~f݅f:[hB+ rGC{JpID*yAY0&̚}Kcuԯ(eϚy|? PC-Yb=yk -Mpc:p#5c: ^ڋYng1ޔW u;:Ҋ ldˁ&|bVW)OlZvU,Q~Xo Rqp&jK[\c6sѧm}o:zuΟ#DyB=}lhlٺl4wKl\ٰO2𞭈?Q\-;- Ne $R=4&8ZѮ[c A\ퟩ W-BĬm1UCb]n;fm$yC8ϳv}m mlc Fmnl6vÛyûM',9NtaiӅַzu\;$@Y#sjƜ-kQߩϞvϞ_m/N/Ӱm]m8qm0,{;{cB0}o͛;fٳkf6뮭nl +ôvMͺv{snmNӧiӧamhٹ(}e?lsDXz:DjYڞ[! Xk9yl Npm7].J 1dx!^N/68ӄٵ6lٳfհ6ͦmsf͛6fͺY/iHY; ;];ۦN6ۦӧmO ]Sj~ǺQšx8ĥװ W |1l8bW8c90}0!bǕv̓ R 햻l7dY\1vUPZλ?#ڞ_~ý/>v[6ճgGV͛Nm8΄=m[6wyt#8rdFl:ώux I`DăgtxE b cQta u)X%Gé'PB="qӴ!tQ[>lbjn[͛ÖtŊ?f-l:öD,;lDNÖm56zj. #?BÞȲnmrV͛1֎oYTm XXZͳff?:g:]tٍuץw[Gmlٳhhfٳf7f6+flfͶٶٶͶh^fٳf͘m6::aX`0 5{׭kݨ{/Dpnf-Ӣomvo`Vͳh66mm6Efٴrٴr͛h[4Tzl=EfͳfoZظKzig #u(3~Bc]n"Daҽ<*S0QƼ"觿zʲxxTVB\~/g 뿅sߛOƉ9ݘBnv"߮vF"CSF1C`c>~kuM%*RzD94 BwTQAEaL:flE5+Maa"zznM"!\{1MRTDu7CШz!0!:`6GD.0 d.ݡuraSbO[DJ"UXwCT@5_ Ǒn6khI\!0`ɏ۝% 1yȝ;C__ѿsXa yꬽ+= ]l0jl1Vp!1U)Ʋ:1F~{vdaQx^x>371 8S7-f?{{t!rg17H8ώq<nnLT'uQ_V`JHk^4݅8jL ya`SpPI쯭{+YvdrڂZ^g{vi?L6c[JUUUUUUV+Qߌw1w2Df OmY2 Gdcr7U&Ak%L]}},quUT ReX\n1&4½*[cź\}33}9F_h1UJ`4eٳJLqb`qU[ھu7tni5l& @ك#bF6`f L |Ok{qv4JC}1&*LH})>~4ʰ\*J8ӼHγYs3'%@j8%*َ$+~5ިTc{ٙWs1)*Q j7_UgDDルT322wqw(&D#v˜u9q.`SY|P xΗ k:L9,NrcF!+'I+K uw?,Ԯ|:#Nf07 i-PS((ܐcBݹ{ SI$z`$Ac%4H[jVq ⩹{;X6l xQ%bUUN!4hŘ2aBf66' x5JE*v2uUe/2\^߽_T$NU@g窽ĉ!B (Xl^haan./X*XXl> A4i Yb٣Xp.4h,4F+\$v 29'3+;`L|js1CCAt[NUp\.Z%433-*SHiҝTS: n[utERhF17٦,\e]ߔj5|fW3yfg-:Eu闵*p'5ałd|WR{W*5]{#{"rOw*{ٕUYY,` }쪔[vk>&ٞч1vw҄YU{+U353cI$Fu-I%qG ḡW擶숕UZuUJ04Jda)!LlsBap`UU8c#V8TB!,MyÆ~N#҆18H!1TR X+>XJ5r|7I]^Oc‰PWpwTX, IEr\E`FS)@%o.XRF&d^:.۪S33j9F+X`zgxY`wyUW3>Ə׽Ƽ nz )5D%2< 1cZm 92˛>|DbxP5"ZPu|Y w emly[h:ވG)WxM4_mdECUtz4+:G3QΨVB@Z[{˨,,, lBJ"@~ս&&8s7` iIycHNٌ̙8;&F,2e˚5 { w\!ɛrGyLWu7W=q#Aܶ\g˓=\7MutWw{yyWy{ڽiƚk˱ǃ-]n RX#eM5+^WTݝD,7&f2dҟioWKnyF#q.I$vqH%!$XIxcL&_>tTj|_z%~S=쏨CWmxM <8pÑЎ8p@Rr ׽:!'^9G9!p+Q*D.2p჉ƹhǭ8{ËY8yGN*Ëy9sa9|_5o7 Ç8pÇ8pÇ8pÇ 8^ZN lÇ9XS- 8 vWZJr8rN8q8q8pkfpÇ9QN8rY SsW4V+Lۜe\U\:6P,%$JYEID>u(†?H UUG Q]#dBT[4M%J*+!,IK$c֑%U^lhӟ,F@BIJ]߸d!&]QS4% $eU -]ZSaqBHYXRU&/vr٪""oRETw|d)"MU*jP] ŘA1^1il."9s$.pg(&)G*>:9fnb|rHUTfϦEy""ԗ1' 1 #@'|}Af"h/3usLE$sƢG[D V %3n|[do$f˿7`}TW}A)[}/wG b}6sCkRT%cKO0vŽA[@b<1a! 9If6R`w)} }} |T`L 7ϟ>h*Fpa}>|2ϨdAzCBobYd/Ė)'Aey:ڪ0O>8>?fIq0mւr$ߌk} f 4O%_L8P7y}]^߈⢨F$h; xalB; 憖 '=@w^b<܅w;Q`tL=nݽ-$SWPf5S?k0{%a5>^QؑG6yJ)%W*ҟ"R_WׯF yW̊ÿGQ~|2Df4sp{֞-)+w.s=e)<}W$CjiPgj}?@ɟ^n/݀BHy'>%_7_?|YT|-EGT}0'~>~o}aY>O j5K*>,X̱¾%__ w %]ZO䬮 F[9fLɇe@UYY["!" "7 \/߈TDBpDl,"DDAD>"!DADלYpD?6 A8"kKnWߠ~o߿$ìASƷkh!/߿ ~1Y߿~ H?K_~v" 2.yDHQQl1%Y2T l7_myEFO[G}GGO%tt ٴw΄~~nиAgLY.(]%)NUU)ӧqgwwLD{)Rz+Y<>/0]j E#d<ԩϤWTTm:TҚzk%ƮeF~:>ipwM_Ѭ%PA=ْTa.<w#O0g߼6uO9>R&ֹ%jJ!FQDz2HCwM~vmrZs\;ߩeVRoϷfH!㤌~m!;3qhf6+ Ύ G+I NiI٨o͝$2][tq;rhOH\wފ;3F63kN6Ki,sK'=Asd:AX˵0S{)=O>  +)mHSL9ɮ}336?0E pBv8v]MvvnXv:NR]DMUUV8SWv{kūVJt+,rR/,i";!LrYeYeYeI$I$K.\rg2?Ir$L${WJRtBR9I40 ^HkKRX%ziF׽)eYeR[8M5{^N~C֔lД% sĒl77D| }9|UPFpFi(͢v;{F 8h wwwwvs9s߸h Ħʛ W29K5+.]H[ t rSm[GCStvldiϲ<{Uhs;h5%_hlT&̨"K/#O5wb\7W,Lw [[ 35oWk&Yr߰ =`i6,?=ٶHcmYez1wwɊz]%x׫v0ĵ{ixgW<ݮzsvբ +A$\@g~zk ML:Ѭ؄uG @%Pzz Ak^d)Vfa2f:=ű@& conn=op= time=[Su([S0L(/cameraCompressed Depth Image Transport - Compression requires single-channel 32bit-floating point or 16bit raw depth images (input format is: bgr8).w/tmp/buildd/ros-hydro-compressed-depth-image-transport-1.8.21-0precise-20140617-1547/src/compressed_depth_publisher.cpp!CompressedDepthPublisher::publish /rosout/camera/image/compressedDepth4/camera/image/compressedDepth/parameter_descriptions//camera/image/compressedDepth/parameter_updates/camera/image/compressed//camera/image/compressed/parameter_descriptions*/camera/image/compressed/parameter_updates /camera/image/camera/image/theora+/camera/image/theora/parameter_descriptions&/camera/image/theora/parameter_updates& conn=op= time=[S)ȱ(~[S0L(/cameraCompressed Depth Image Transport - Compression requires single-channel 32bit-floating point or 16bit raw depth images (input format is: bgr8).w/tmp/buildd/ros-hydro-compressed-depth-image-transport-1.8.21-0precise-20140617-1547/src/compressed_depth_publisher.cpp!CompressedDepthPublisher::publish /rosout/camera/image/compressedDepth4/camera/image/compressedDepth/parameter_descriptions//camera/image/compressedDepth/parameter_updates/camera/image/compressed//camera/image/compressed/parameter_descriptions*/camera/image/compressed/parameter_updates /camera/image/camera/image/theora+/camera/image/theora/parameter_descriptions&/camera/image/theora/parameter_updates& conn= op= time=[SY))`[Sd(imagebgr8; jpeg compressed bgr8_JFIFC   %# , #&')*)-0-(0%()(C   (((((((((((((((((((((((((((((((((((((((((((((((((((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?xm">w#h8j9f8j94i/^mڵ-ץKҮD +ҭļXҥ NxBRP1RB`0-<-8 pZaTfipS$pWړn*䰕=*2WqN_Jh}*V_Jn(S.1H u4u0J)1KHMDE*QMpBZm-N(ZhbMQE )(1fŤ1 Fi IL4J;AKLCF(A<PZu%fLRQ@ II3@ HhES@-f 3ILE74@%%4HM)&LfњJ))((fNRh *]EWZ*@|cnҰ]^m H;X~XUϽl+׋(xnقv;+Ljk=ka4OM[.O<&Gb=0zVxyILzJ hOWk?h)aCqBHwZSP ´ҳԘQO!Q,Ii0m< 4RI@!4Y|&iPn*R)Pi)RbKEREQE (EPKmFiPPh4(@QL4f@8fL1٤%%J3@ Fi@Rf4&i3E-%&is@hh,1sFi(BJ(NcS $CV"UXuGH<;>ßa!:FڎY -bk(ˌBcuҮ9܋xoMSl1'ӠL̯pqk!'dnaQ5LlKHs1M=iZ셌'jNd-rsyW_+<<4Hkg#ֶe-jЇAcjqZIAXjqVcRf`ijM 'sHcM4yiIN4JQIMښyi'BE[5 zACRM"#)i1@ QK1@ ZJ@(4RJ)ؤ\R@1E% &iM&(3A()3Ji)RRъ`%QH(%-%QEQI@ ERQH(.QpF)⁒/ZQU֬Eڐ}xiKoaʞypW9CƠ{Q[p_f}>^g_8ub&FNzy3ŢA"XCی]Jֶ[۷*en1UWUKnXȻ9Vn5Oµ"Oa`1zцt VBeOZDHSS$NZI=MLT*Er(eޔsOݚVM!&RfiQHMcM!)X1ҙE1!␭0LTȤRHE#;1SH6Ѷ#1Ff(<1@ .)أRb7Q~)E:JLRbHh)Ԙ)R@7Rb3 Y!fi &FXIZ88JR et5'tW,{)f^ Bo}m'A5dtsA 5PAhAEPEPQKE )R@QOZh-=zՈzՈC<7\}j;[RAOz!4  ¾]LSam)4cc+"qm>Wa }l44˅oZߡ\JKK*n9ӹ@/Q}_zXӓ0ؼ ү#n=|F@_Ht}0>/S}x>nhl*|9 g>:6@_H.tCl)r>x8n.zu)NO1zg_}֘C)@mا>vu2{}~R`Fam~7j>𣑅|USq 1|SX G~>m?Mo hl0t1P<8>>mE9~*ew>Џ]:SOt#N>E/W|2zZQNr9Pk|C袣#@"0}Rax.|;/| hR|?J&6ğ'>˜坜k(axH>&ÑCSЈP=>B@ c.,zx>#d )4]wOF/8O4qS&Ie+G)?BI$vhrtbq{H~!胆]#xM@S">8ݦ*?ԷSb['h5xN? 2`h;v Oz{T-3 F"5jFt^GlF\V9OukxÇ\Gx5#)>c>.[~chÇm}(n˼9pSO,H"bc>+mI Wαh?cko ?g?SG,H!&;J=AOx|lO,O&تZ&lX4B I ???ƙw}7(|U a[3U$)_c:l{|s֣=P!$i*?+Fw6"?selQإЧK dlG-<\b(dU_ƐΥF- =pJ~UoʚZ:P-=!F ]ծ_um2k4sMIN}xV@M?kҼoް}S^* )\8]CZ:WJ{h:ƒ0zfGF,1_ 5\[a--h3PVIV#.KXlzjv?Ndj685ͣ c؀G٢Udy4{0=/m_yb۟l^,4{%[xiWK#J{PxKN;Mٶ >hπ3&??N{g=b;#+gz>4 s}=#c՘ak g?h85-TcOE1}EWQQEQEQEQEIQ_T< Gmr3/|A -Ѭl߼ǻT9)IGsx~UխdĎOs^i|~Y0( ׊JHq;r|'jwaYFeZb; 2ș>+*6Y1v˴5KIMf$qP@Ъ.'#w-Y٫2{ W<;X~"~ 률?֭[|\dLDgysB"F{5<+&p]o#n]ׇ/;Z)u/>wbŴ&crF2 tZ}mq K- st=GVjS$xWO㼰v5?ە'MKcE3qP;Vv6iy^Cul!pq=s5/MaT$_4p3~t(Q*3?rQ֦8c+XU5ʤ *iB‹YD¬Q88_@ T:.) P0_B#S?J2&TQ1ÊwBA拕a.Mazܤ'SR䖬ڍU,Kשo=+Ťb4ˋrryRpMsT}U~>^ILw$bIXipw-i4&P+ 4i1M7RZNWi:SM36V=1Prҙҕ[kMZhհ՞7 7+5*nCkfjՍ얲 SaQg&)=^ωV>"i~O@&C꧌ׁ,4m(p}AW]G&Zozȱiԛ݊}U=sMڣxϘZrΡ Kz/¤R] ֧Y9ֹXyӚMP[ dM8TqP94D TDB;Ҙ7&qS5B4 T-SjDa@FƣzMHv#4Ӛq\xHSMHߕ M5O)9ɩo'sYIRnLRIj? 4͞`QE"N"#hPKL4HE4KA4czJi !M4M4؝  3#CNkiOQ]4nt9SҸ>^snմ$ތ1eR]o._B_=HNj$>FhFpxW +I[DpիCdPHH]5j~i\Qzk\M1)Xd¸Lfv'h9fɨٹ5xb MfE ]iE1 gLJE&H 3!l ,k^|7" DAmrŔ}'5,r&Ѫzjy/֭EU6ڙ'[T ΄zD7?^yݶ&u,C;޴5 nWm}sZvy@ڲȁOzku?*@&6 j8e T &d,*'UtXqP2Ê@TP1J PI@]oR=FԆn)+BǠꓙ5Ͷ0Zu<=Yt=fe̙cTdbO5,{UrrkӍRw`4QE FKIA,mQLBI4ZCL%!KҐĤ4香 I\9Ri!*<Ӂ袊0 ( 󯌾(mF]>t^$m$*(&a6t>\#={+Ǖnl *s9pܚힵ; V#v[=5uNi)$13L< s7LӰFO<GS)i'lՅ{3Ffִ&ؤKZf/5i}do7NkV48MS#r1)^}ipxJ eNAVF?k 2hk&B⠐UEZY@4@T* T-4b,=jVjLIS=S}qR٬#wc&+oܱ'k߾2;\sw> O$2GNb{jUlQEQEŒSI9aJ mT`JiSM&i(!SIL%!4L=iiHCHzRHɍ UEt;RMs,kKLdz4/N[հxE8@ J\QaEbQEr52$ikYWȁ#9>[Mi O^Ix䱬=8ji"jRsU$rk:TmqDHzS\`S-"4)>Xb`sF© "nOQ*s֫RDZ u!M4Ҙi"XPi*i)i)؆CM4M4Hin8Vd6Sw8Q9]NƳEOt3L0(q#*U ▀>S#h07j#vZVw2? Kh?[k@]8x)(4 f4d!qFq@4v<ޜ44a1C6iRfm4CbRZi3aM4Fl3HzQMCcM!KHi) &On5hB5XןU<ս,fV>'&!*PִG[SujqS+P" ]B;!hEPNJsW Pi⹻ɮYA Jx]u5-)=B< w"`RtT\㞴g=jěGZHdFiyYI8jHmI\>:@` G /r\" ژS9FoSY}+n6@8'@8]ڝ!%T"ڍ4x4sE1) 8MԸnj'*V4ir")Ojc "6=)S Fʑ UnT1.%ǽNL1XTQ/*KJ5' "Z TP-kXK*y" 2ߡq|XQlZG+N%<}H1R5CI(4BLcN&ƑDmң4r*3@1֧jKFg@RVb,7EuZS$HٟCa81LjpzUvYً 1H3IIEBi3Ib@M4JdQHi؄Ri 4KM'iQ*фMnxiV&p\*.OJRyVEH)SUBTRMH(`'JzT jQ@eQ]!EPke#jě + g>;Kjj9}<J y֧0@n!9~Vq׫wHH +2XhW>=M=QY2:$SU"f6YviTnriQZ'aZV@b28`c@JN)=*fFGJv j>dDSzgjR /5BiXSjG5 #&3HWma)v"p95PGzVde:Z[_j6K[۞~+\'6*[r8 V,:+jQ`# ъt$0ULt HڥUHN(0xSC@M#!Tf2&H0H&| {g8w#zJcEZKDzt'Rek5`BjwW= %R"#*l]BP#޳B:GӮ00XRmM&TE0JZ5Fmii& "3&M=vTDZ r=2E=!"`>&k͇Ɯ|-LҺ+='c Nn?ǰqZ9r4'?>=M~hH,:W|}iyI ܚi,v_4ņ>Fٹ d tgj!ιFNJ?2X0BۥD⹳u)?,'>;\.tDTMְ?*=.š|Oa..Qܻqܮ뒿+"+}OaT7qga± ;pFXU_J߻N.+6a ?$\2PS3!-FG#ڡ1BgW:dM֓4SL Ր؄fHi4C`Z⑰`>$~ =UXuTwddSi\W¼QI:1mDϭMҟ/F~V5LSjw1K/KT4I\XUs?Sp&RK_M6=4h<T"aL6M7ȵA Tr4rtRG-+/Jv xm3e*v- /xJ_&8G^ sN. (p>W_Cyv}jq dk)BrgMMY9JQzgf[oFyA^6=hRH6S]jG0W1)Xi TlU+Ln8ʜY}iܤ˚4lWm4o4"% Z:YѴn[h6Hs\NvFF_&X"Sd<"0z(y cD]V/c!EHcF`(񁙥fah Щ'ܜu?f,,XA-kdWkkR}dcWғYL*)0( j?/R{_ gm4Z feg~*ZLP;s ?Hm-36¬HETZsg~)d?VȦ YL) Yg/UPCceeM66? piHX:)O=tnxiHymS̰t V3LӰsX^7zVZ 3K'S[JU6VP:V:VO{'SN;'ٓ+@B(;#I>ӣi?´Ht]ѴnE6ӂ[E4;?׌mY;6~ꑡ6wX设Y?Mz%Ko ]Xm#Ů|AߦnrUj͛Hk#?8oΧٮ1>ymU$o#Oě".?3_@y?:iw]:j j><%]ְ[V~p?啼x 5y'(Z.Ug;/új˞vb\xCqdҶP܏ݜSg>VyBY[*#1a(aZ'61Q\[XB5UXW76Z'^_P7\@Nv=OZjӮ-}(cm1QF%RNcu0#Ofq&ќֆfd ddɻ5{Vp[;GZb$f}Lb,Ŵ*ִ13kA} /U4<6ds:Wa\RC9}kѬ3^oz-E[Dv謟fП0WEgRY㩥99u$}~,k,cow(2ki ý̍49Pyy+pn>(RG^D1|9<-!:&#"!#]rQ?\|k郚m|HsڱIreH>TȬ}{ GigC+[`>5ps_5wFT*Q턂9?gCi5Fڢt+S+Ծx2@o[vG!î6|Q^94m3Y[%r̬TOѵkŞ6y9 òtWd{GP a8ySXWömXlפpAUbgC1F)EIHhH!TR@bTRb#M""␊n(2)jR(2)"""!Q`"!&)DS R@J()TSM5%4 4ZiR(4ti5 niH ~⣹ .c+I!;h[n)|~56M.O8\֑^Dl7 wl&Bcִ]7P2MQ1@/|tO)&rvrǑZe$sTc"(G OW1+?Fp  K,Fj4dEe#SwHMSIC2[8TMXGV_"` QGpѬ [H],Ը,K6{+}lyD!ۨ(nV.3ݙm}65Qٯ!ު{lǘTl.%JB fƎISPk4բET3οRzץi:WF463jI6[6sS_4,R`ܙ~|c9"Fͣ2zWSOP>o[pe%*V rN@w)-W Scjڃ;Z+FJ[;a;w7L ߭:ssJY\= u ywor+?'3W۶PPC4!NO3ZѰk[Mr1J7!4m@R=Q)XWȞ&Ԧּ]Qe#ʯ9 l4$-H_ J2fuiڙGA$7òSyǮk>|;1^+zVqTZlX'#+Ю<]D')1+F*Y9b9sӟ)].e< 3>sϖk5Ԑ暲VldK=y4 JiGhbqߥv!0$*|`PJڳsjwcRIO]< $MD9S^۠  ek^ <ⲓ-;SZ85d `Y e8+ b:,33↳oTى=bz(>q47(}|o~# ⩌C!=] v?ZRrĚzխft1#S}\QM& Eg$HܿS}A(FkܶGgO1Gڴ@H5d ZԩqN_) 05 l(`I\hӰeܲV"*;ir(֡r֥)cJI4R@Vp:g]]8 yHucihx\V2V4zҵBSln<Saܾ*EQG42j҇ζWZcϵKeܬq%!P kPd2ZOT/dw#2BxQY˓SgORzMv5 JEmQ$#ٮtTpI l8qǝ 8 0A¸8l@pYT};׸9m#C14xv/O*HCkmMc30+A:؞-\,E*ֲl$2`Q޵B4p(kG/|\?+{ۆ\d5b_ZGqI>V*>0W-O_cZF}z;i& kQLsys\|kRH3J\ M!!4L&i&M&&4iM&MM)4h'i4RqIƛ% Fj h&iAa4iyNEP%54ӅBJNf3TVcpWVI[xDIFBdfrE9hO&7(uZk~s.'A}laaPlIՕ*ʜ~j7pȱw8U˻_K`cQB6OZWj*+3frbj#ɭ$Ҧdq$vgma{5CYw`FG?E&Dp?thҐOy՘VzGO֕,sL39WA0ϪΝ󫲓iڪ7v,AV\#ua/-wapj7l-qMZ c$ 0ĆFSp[_gi` qGCWmZs 8}jj-H 괻庈8u[Y\Ԁ50Ӎ0.L&ƘM IBifiI8i4 $3M5`y7?4#~!ܶes+3uLX{WQgm #QancC =4SJ,ŇK߹}gFqº[Op5`sS3RqO1)j{Dz~?VyNʠ MtVZqŢ 8 eȮ:PW[wCj@5<÷N5Wf ROTPl\.MimIݛI9$z@aNj9Pۈ1Y GZ&*Tg }Dь3>.&s#;'5Ē9;lu5WQؓċB=?ћSI9;U?] gKf9q@ج}h'9ޚ[B3|IZi?1fb#L-02h$`搈.Kj;OOZt_]ݯApλ+ D4]uA\~uGDJ6`Xzq8_Fd#rc'Ou2)SL_Q<o.נxd,Oz(ʽx#J?"rNq從Xޥ4,]U= 8>)no4zk^..^6pE_^{hs˛en +Yp^2tyev3)S#\eiv P&^ ?Sq66IQJoZyC'Ef+ GZAsCy`hwolx#+Wk?T+CYϪ'n7s?qVmw43jPci8Ӥ8^:d9Hd8;sҞ8Lf4)Y4Q}O7}uZ;o뻵\fFuD+[Y)&U=\U+_J;}Gc'.GS=륵JDYNWv--.$6"P:}MN@^)?Zi+k4ZJ HM+qMQҢ@(;`{wޣzI.i$ NDҏQM&i9Kޚ\zӰKZZ,sw0<3ak]?.Ec-rn x .4qw+m9T0rݾt0gؖ.I'_J-ZPxuk8^G8Sikq|cYHMi2E5*6 VCVIc> q0Vq,;(=]9l!ƘiI)M!1) -Ȥ3HiSH7UAIugK-Z*RPDF.Z[լ!W7 m¯NH|m?!GWyV{S}>]2}%堽Z0x69 2эt„kKؿNf=Q@i}޴(d)_9QDXZ_ZB{Iw**1P3{y_#ޕsN d ϭ gpp$X7l` X@Ts -j<ƟQ&敎4nw:SI+a5IO&[ҋۃS0l,>ᩖZ?1?wvq~ mq\zDҏvD/u:C?XL @:^,ƓDNGeF+)J-#ZeGm\=9:Vn BVE wzc)q@J怸u.G?7,SWxPQ- 8 q?̸K@_ܥ+VlW+xN$Dwҹ{VW雪))/Jm$AC WzƶU©?,s4X_*7H*J65rp#VWVV5]iPKD'YX][Hq#S}I;/֝?^p5[m1+{ԉxz#պe:?T+܃ަI5 G4 Fe# gϹ\厛um?9ح[x4JNKi:va5q `C(ĩ޹pzqvYHg'ȹ8XZP;l[9O5x5dXhK5D"O-W)a7ܶiq4lg41IRf3HMHX3N2uSQ9%fAufH{}Eh^GQL ~WZ0;.840{j?uEjUݹWճاSXq~ƝenLsɩ9sL*r徆%M~KL_zVp:B&j˜nW֭A,3`qQL0 O0 9@4oȣ5kM& conn= op= time=[S/).[Sd(imagebgr8 2(!3)!5+#7-#8,%:.%:.&;/'<0)>2+@4.C7-E60H93J>5L@;OE>RH@TJDXNAXTD[WF^WH`YIcVJdWLfYPj]Sj_VmbZmg\oi[rn\so^uqaxtfxuhzwj|yl~{l}npqstwxz|}~~"/-%20$5.%6/!7/#91:1:1!<3#>5$?4(C8.E90G;5I?8LB;OE?SI?VKAXM@YUB[WD_VFaXGbWIdYMf[Oh]RjcTleZli]ol\pn_sqauscwueyvfzwe~zf{h}jnortwx{}~~ 0-"2/"5/#60 80!91:/ ;0"=4#>5%@7(C:,D3%?8(B;*D=-G@1IB5MF9OG=SK@UOBWQEYVH\YI^XK`ZLbZNd\Oc`QebRieUlhRniVrmVtoWup^ws`yuc|xd}yfxhzl}m~rtuwxz|~2,!4.6/708-!:/#:/%<1%<1'>3)?7-C;.B?2FC4IC7LF:QE>UIBVNEYQHZWK]ZH_[I`\Kc[Me]Pe_RgaTicWlfRofUriXulZwn_yra{tc}vexhyiznpstvwx{}~"2-#3. 6.!7/"9.#:/&;/'<0*=1+>2,@6/C90C=4GA5KC7ME:QE>UIBVLFZPH[UJ]WGaZHb[Kc[Nf^Re_UhbVheZliWohZrk]un_wpbyud{wf~wgxjyl{o~psuwxy{}~%4-'6/#7-#7-!8-#:/%:.'<0(<2)=3-A7/C91E;4H>4JB8NF:QF=TI@UODYSF[UI^XIaZJb[Lc_Md`QebRfcVjgXliZnk]qn]tp`wsbyuczvh|yi}zj~{m~lnrtuvz|~"3,#4-#7-#7-"9."9.$:2%;3(=1*?3.A51D82E95H<6JB9ME2*?3/B61D81E;4H>6IC;NHTLCVPEXRHZWL^[IaYKc[Kf]Lg^PhaQibZli[mj[pj^sm^voayrdxueyvh|yj~{m|pqrtvxy{} 3-!4. 6.!7/"9.$;0&;/'<0,<1-=2.>33C82D:6H>7KC:NF=QGAUKCWOG[SH[UL_YLcXLcXOe]Qg_TgaVicYkh[mj[ol\pm`tqbvsfxuhzwj{zl}|n{o|rstwz|} 4,!5-8-8-:/ ;0"6.@61C94F<7I?8MA;PD?THAVJDYMH]QJ_SMbVKdYLeZMfbMfbPgcSjfVmiXokYqj\tm^uq`wsbyud{wk}zl~{n{p}rsvxy{}~3)!5+"6,#7-"9.#:/%<1&=2'>3(?4,@8/C;3C>7GB:KD=NG@RHCUKFXNJ\RJ^TMaWMc[Nd\Og`PhaRfcUifXliZnk\pm^ro\uq^wsbxvdzxj|yl~{n{p}rtwxyzy{ 4,"6.!8-!8-!;."3#>3)>8,A;0B?4FC7IF;MJ>QKATNEXRGZTJ`XKaYMc[Pf^Qf`RgaUgdWifZkj\ml\pm^ro\uq^ws`xxayyf}yh{j}nnqstwyz|6* 7+!8,"9- ;+!<,!?-"@.%@0'B2,@6/C90C=4GA8LD;OG?THAVJDXNI]SK_UNbXOdXQfZTh^Th^VicYlfZli\nk]rl^sm[wp]yr^zua}xgxhylzn|p~suwy|